DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tra2 and Rbmyf9

DIOPT Version :10

Sequence 1:NP_476764.1 Gene:tra2 / 36619 FlyBaseID:FBgn0003742 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001257441.1 Gene:Rbmyf9 / 100041505 MGIID:3781554 Length:380 Species:Mus musculus


Alignment Length:190 Identity:55/190 - (28%)
Similarity:91/190 - (47%) Gaps:36/190 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 IGVFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYFEKLSDARAAKDSCSGIEV 163
            |.:.|||..|.|..::|:|.::||:.|:.::.|.:|::||||.|:.|.:.:||:.|....:|:.:
Mouse    10 IFIGGLNIKTRQKTLQEIFGRFGPVARVILMRDRETKKSRGFAFLTFRRPADAKNAVKEMNGVIL 74

  Fly   164 DGRRIRVDFSITQRAHTPTPGVYLGRQPRGKAPRSFSPRRGR-------RVYHDRSAS-PY---- 216
            ||:||:|     ::|..|: .:..|.:   |.|.|||..||.       |....|:.| |.    
Mouse    75 DGKRIKV-----KQARRPS-SLESGSK---KRPPSFSRTRGASRILKCGRGGRSRARSGPSCEGN 130

  Fly   217 ---DNYRDRYDYRNDRYDRNLRRSPSRNR------------YTRNRSYSRSRSPQLRRTS 261
               |.|...::..:......::|:||..|            .||:.:..|.|.|..|..|
Mouse   131 LGGDRYTPNFNVSSSGRHFAVKRNPSSKRDGPPSKRSATSAQTRSNTGLRGREPHRREIS 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tra2NP_476764.1 RRM_TRA2 96..175 CDD:409798 28/75 (37%)
Rbmyf9NP_001257441.1 RRM_SF 7..86 CDD:473069 29/80 (36%)
PABP-1234 <10..207 CDD:130689 55/190 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 82..226 27/113 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 279..358
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.