DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tra2 and srsf4

DIOPT Version :10

Sequence 1:NP_476764.1 Gene:tra2 / 36619 FlyBaseID:FBgn0003742 Length:264 Species:Drosophila melanogaster
Sequence 2:XP_004911639.2 Gene:srsf4 / 100038227 XenbaseID:XB-GENE-493077 Length:741 Species:Xenopus tropicalis


Alignment Length:298 Identity:77/298 - (25%)
Similarity:108/298 - (36%) Gaps:89/298 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SSGRLHCSARYKHKRSASSSSAG--TTSSGHKDRRSDYDYCGSRRHQRSSSRRRSRSRSSSE--- 66
            |.||....:..|.:|::.|:|.|  |:.|..|.|:........||..||.|:.|..|||.|:   
 Frog   384 SKGRRASRSASKERRASRSASKGRRTSRSASKGRQESRSVSKGRRESRSVSKGRRESRSVSKGRR 448

  Fly    67 -------------SPPPEPR----HRSGRSSR--------------DRERMHKSREHPQASRCIG 100
                         |...|.|    |..||:||              |.|| .|||...:      
 Frog   449 ESRSVSKGRRETRSVSKERRGSSDHSKGRASRSQSKDRANGRDKSADSER-SKSRSRSR------ 506

  Fly   101 VFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYFEKLS-----DARAAKDSCSG 160
              |.....||.|.|:        ||:....:....||:.      .:||     |.:...:|...
 Frog   507 --GRRETDSQSKERK--------ERVSRSTERSRSRSKE------RRLSRSNSRDKKGRNESTER 555

  Fly   161 IEVDGRRIRVDFSITQRAHTPTPGVYLGRQPRGKAPRSFSPRRGRRVYHDRSASPYDNYRDRYDY 225
            .|::.|:       ..|:|:        |:.|         .|.:...|.||...:...|.|...
 Frog   556 QELNSRK-------RDRSHS--------RERR---------NRSKDRDHIRSKDKHSRNRSRDRK 596

  Fly   226 RNDRYDRNLRRSPSRNRYTRNRSYSRSRSPQLRRTSSR 263
            |:...||:..|...|:| .|:||..|||..:..|.|||
 Frog   597 RSRSRDRSRERQSKRSR-DRSRSKERSRRSERSRRSSR 633

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tra2NP_476764.1 RRM_TRA2 96..175 CDD:409798 15/83 (18%)
srsf4XP_004911639.2 RRM_SF 6..77 CDD:473069
RRM_SF 104..176 CDD:473069
PTZ00121 <248..716 CDD:173412 77/298 (26%)
PRK12678 255..>469 CDD:237171 24/84 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.