DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Polr1A and Polr3A

DIOPT Version :10

Sequence 1:NP_523743.1 Gene:Polr1A / 36617 FlyBaseID:FBgn0019938 Length:1642 Species:Drosophila melanogaster
Sequence 2:XP_061508566.1 Gene:Polr3A / 1278527 VectorBaseID:AGAMI1_008869 Length:1384 Species:Anopheles gambiae


Alignment Length:96 Identity:19/96 - (19%)
Similarity:34/96 - (35%) Gaps:26/96 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 HLLTVGRYTYTSDQRFRAIHHPHTEDWSLQI----KYPQ-----HRDSGIYECQISTTPHMSHFV 221
            ||..:||::           .||:..::.||    :|..     :||.......|.:|.      
Mosquito   151 HLRRIGRFS-----------EPHSRFYAAQIVLAFEYLHSLDLIYRDLKPENLLIDSTG------ 198

  Fly   222 HLNVIGKHRSPTAQPSSWVKLALPSTRSPEI 252
            :|.:.....:...:..:|.....|...:|||
Mosquito   199 YLKITDFGFAKRVKGRTWTLCGTPEYLAPEI 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Polr1ANP_523743.1 RNAP_I_RPA1_N 18..982 CDD:259844 19/96 (20%)
HMG-box_SF 1065..1119 CDD:438789
RNAP_I_Rpa1_C 1166..1638 CDD:132722
Polr3AXP_061508566.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.