DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12869 and si:dkey-193c22.1

DIOPT Version :9

Sequence 1:NP_001369085.1 Gene:CG12869 / 36616 FlyBaseID:FBgn0033943 Length:839 Species:Drosophila melanogaster
Sequence 2:NP_001093504.1 Gene:si:dkey-193c22.1 / 567837 ZFINID:ZDB-GENE-030131-7957 Length:370 Species:Danio rerio


Alignment Length:291 Identity:61/291 - (20%)
Similarity:99/291 - (34%) Gaps:122/291 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 LIGLK--VFPDGTRGAVYAFLGIPYAQAPINELRFA-PAKPSSSFNRTLQATTMQPLCPQLANTI 99
            :|.||  |......||:  .:|:||:.:.:.:..:. |.||.                       
Zfish     1 MISLKCCVSIPAVAGAL--LVGLPYSISLVAQWLYGWPNKPG----------------------- 40

  Fly   100 YDESSDGSMPRSVSTDEDCLYLNIWTPESGMRYGKLPIVVIVTGEEFAYDWP---------RNRI 155
            |.:..:...||.:.    ||...:......::||||           .:.|.         ::.:
Zfish    41 YQKYIEALKPRRIY----CLARAVLEMLKYLQYGKL-----------YFQWKLWYSNDKNNKHYV 90

  Fly   156 NG-----------------LDLAGEGIVVVSVQYRNNIYG--WLSLGEQHRNVPGNYGLSDVQMA 201
            .|                 |:|:.|..|.|.|    .:||  |   |...|::   |.|..:|||
Zfish    91 KGITFGRRGNKLDLYYSPRLELSDESPVPVVV----FVYGGAW---GSGDRSI---YCLLALQMA 145

  Fly   202 ------------------------------LRWIRRNADAFGGNPDHITLLGHGSGGAPLALVAT 236
                                          |.|:|:...||..:.|:|.|:|| |.||.|..:.:
Zfish   146 KELNASVICPDYSIYPKGNVLNMVQDISDSLLWVRQKGHAFSLDQDNIILIGH-SAGAHLCALTS 209

  Fly   237 LEDSSQVKQLVLMSPGPIMRALGQNHQKWIV 267
            |..:|.|::|.:.:          |.||.:|
Zfish   210 LFLASNVEELFIET----------NKQKDLV 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12869NP_001369085.1 COesterase 27..541 CDD:395084 61/291 (21%)
si:dkey-193c22.1NP_001093504.1 Aes 87..336 CDD:223730 39/165 (24%)
Abhydrolase 121..>210 CDD:304388 25/99 (25%)
Abhydrolase 167..336 CDD:304388 22/75 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.