DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LamC and KRT75

DIOPT Version :9

Sequence 1:NP_001260974.1 Gene:LamC / 36615 FlyBaseID:FBgn0010397 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_004684.2 Gene:KRT75 / 9119 HGNCID:24431 Length:551 Species:Homo sapiens


Alignment Length:509 Identity:129/509 - (25%)
Similarity:215/509 - (42%) Gaps:105/509 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ARRVTLNTRVSRASTSTPVG-GASTSSRVGATS--------------PTSPT------------- 39
            |:||::|    ...:|...| |...|:|.|..|              |:.|.             
Human    68 AKRVSIN----GCGSSCRSGFGGRASNRFGVNSGFGYGGGVGGGFSGPSFPVCPPGGIQEVTVNQ 128

  Fly    40 --------------RTSRQQEKEELQHLNDRLACYIDRMRNLENENSRLTQELNLAQDTVNRET- 89
                          :..|.:|:|:::.||::.|.:||::|.||.:|..|..:..|.|:..:|.. 
Human   129 SLLTPLHLQIDPTIQRVRAEEREQIKTLNNKFASFIDKVRFLEQQNKVLETKWALLQEQGSRTVR 193

  Fly    90 SNLKAVYEKELAAARKLLDETAKEKAKLEIDIKRLWEENDDLKPRLDKKTKEATVAENNARLYEN 154
            .||:.:::...:..|:.|:....|:.:||.:::.:.:..:|.|.|                 ||:
Human   194 QNLEPLFDSYTSELRRQLESITTERGRLEAELRNMQDVVEDFKVR-----------------YED 241

  Fly   155 RYNEVNGKYNQSLADRKKFEDQAKELALENERLRRQLDDLRKQLEAETLARVDLENQNQSLREEL 219
            ..|                    |..|.|||.:.     |:|.::|..:.:|:||.:.:||.||:
Human   242 EIN--------------------KRTAAENEFVA-----LKKDVDAAYMNKVELEAKVKSLPEEI 281

  Fly   220 AFKDQVHTQELTETRSRRQIEISEIDGRLSRQYEAKLQQSLQELRDQYEGQMRINREEIELLYDN 284
            .|...|...||::.::  |:..:.:...:.......|...:.|::.|||.....:|.|.|..|..
Human   282 NFIHSVFDAELSQLQT--QVGDTSVVLSMDNNRNLDLDSIIAEVKAQYEDIANRSRAEAESWYQT 344

  Fly   285 EIQNLKAAANRAAQGSALATEEVRLMRTKIDGLNAKLQNLEDTNAGLNARIRELENLLDTERQRH 349
            :.:.|:..|.|.........:|:..|...|..|.|::.:::...:.|...|.:.|...:...:..
Human   345 KYEELQVTAGRHGDDLRNTKQEISEMNRMIQRLRAEIDSVKKQCSSLQTAIADAEQRGELALKDA 409

  Fly   350 NQYIASLEAELQRMRDEMAHQLQEYQGLMDIKVSLDLEIAAYDKLLCGEERRLNIESPGRPTTDS 414
            ...:..||..||:.:.:||..|:|||.||:||::||:|||.|.|||.|||.||:.|... |...|
Human   410 RAKLVDLEEALQKAKQDMARLLREYQELMNIKLALDVEIATYRKLLEGEECRLSGEGVS-PVNIS 473

  Fly   415 GISSNGSHLTASASSRSG-----------RVTPSGRRSATPGISGS--SAVKRR 455
            .::|..|....|.||..|           ..|.||..|...|:.||  ||...|
Human   474 VVTSTLSSGYGSGSSIGGGNLGLGGGSGYSFTTSGGHSLGAGLGGSGFSATSNR 527

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LamCNP_001260974.1 Filament 45..401 CDD:278467 94/356 (26%)
ATP-synt_B <67..>142 CDD:304375 17/75 (23%)
MreC <178..>224 CDD:302802 16/45 (36%)
LTD 473..574 CDD:279300
KRT75NP_004684.2 Head 1..148 14/83 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
Keratin_2_head 16..145 CDD:292825 13/80 (16%)
Filament 148..461 CDD:278467 94/356 (26%)
Coil 1A 149..184 12/34 (35%)
Linker 1 185..203 4/17 (24%)
Coil 1B 204..296 30/133 (23%)
Linker 12 297..319 2/23 (9%)
Coil 2 320..458 42/137 (31%)
DUF883 374..>434 CDD:295076 13/59 (22%)
Tail 459..551 22/70 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 529..551
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.