DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LamC and Nefl

DIOPT Version :9

Sequence 1:NP_001260974.1 Gene:LamC / 36615 FlyBaseID:FBgn0010397 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_113971.1 Gene:Nefl / 83613 RGDID:621458 Length:542 Species:Rattus norvegicus


Alignment Length:552 Identity:150/552 - (27%)
Similarity:244/552 - (44%) Gaps:92/552 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SARRVTLNTRVSRASTSTPVGGA-----STSSRVGATSP-------------TSPTRTSRQQEKE 48
            |.|......|.:.:|.|.||..:     |.||..|:..|             ::..::.|.|||.
  Rat    28 SVRSGYSTARSAYSSYSAPVSSSLSVRRSYSSSSGSLMPSLENLDLSQVAAISNDLKSIRTQEKA 92

  Fly    49 ELQHLNDRLACYIDRMRNLENENSRLTQELNLAQDTVNRETSNLKAVYEKELAAARKLLDETAKE 113
            :||.||||.|.:|:|:..||.:|..|..|| |.....:.|.|..:|:||:|:...|...::...|
  Rat    93 QLQDLNDRFASFIERVHELEQQNKVLEAEL-LVLRQKHSEPSRFRALYEQEIRDLRLAAEDATNE 156

  Fly   114 KAKLEIDIKRLWEENDDLKPRLDKKTKEATVAENNARLYENRYNEVNGKYNQSLADRKKFEDQAK 178
            |..|:       .|.:.|              |...|..:.||                     :
  Rat   157 KQALQ-------GEREGL--------------EETLRNLQARY---------------------E 179

  Fly   179 ELALENERLRRQLDDLRKQLEAETLARVDLENQNQSLREELAFKDQVHTQELTETRSRRQIEISE 243
            |..|..|....:|.:.||..:...|||.:||.:..||.:|:||..:||.:|:.|.::  ||:.::
  Rat   180 EEVLSREDAEGRLMEARKGADEAALARAELEKRIDSLMDEIAFLKKVHEEEIAELQA--QIQYAQ 242

  Fly   244 IDGRLSRQYEAKLQQSLQELRDQYEGQMRINREEIELLYDNEIQNLKAAANRAAQGSALATEEVR 308
            |...:....:..|..:|:::|.|||.....|.:..|..:.:....|..:|.:.......|.:||.
  Rat   243 ISVEMDVSSKPDLSAALKDIRAQYEKLAAKNMQNAEEWFKSRFTVLTESAAKNTDAVRAAKDEVS 307

  Fly   309 LMRTKIDGLNAKLQNLEDTNAGLNARIRELENLLDTERQRHNQYIASLEAELQRMRDEMAHQLQE 373
            ..|..:.....:::.....|..|..:::|||:..:.:.......|..||.||:..:.|||..|:|
  Rat   308 ESRRLLKAKTLEIEACRGMNEALEKQLQELEDKQNADISAMQDTINKLENELRSTKSEMARYLKE 372

  Fly   374 YQGLMDIKVSLDLEIAAYDKLLCGEERRLNIESPGRPTTDSGISSNGSHLTASASSRSGRVTPSG 438
            ||.|:::|::||:|||||.|||.|||.||:..|.|..|  ||.|        .:|...||...||
  Rat   373 YQDLLNVKMALDIEIAAYRKLLEGEETRLSFTSVGSIT--SGYS--------QSSQVFGRSAYSG 427

  Fly   439 RRSATPGISG-------SSAVKRRRTVIDESEDRTLSEYSVN-AAAKGDLEIIEADVEGRFIKLH 495
            .:|::..:|.       :|.|:..::.::|:.:.|.:|.:.: ..::|:.|..|.:.|       
  Rat   428 LQSSSYLMSARAFPAYYTSHVQEEQSEVEETIEATKAEEAKDEPPSEGEAEEEEKEKE------- 485

  Fly   496 NKGTEEINLTGWQLTRIAGDEELAFKFSRGSK 527
             :|.||   .|.:....|.||....|...|.:
  Rat   486 -EGEEE---EGAEEEEAAKDESEDAKEEEGGE 513

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LamCNP_001260974.1 Filament 45..401 CDD:278467 104/355 (29%)
ATP-synt_B <67..>142 CDD:304375 19/74 (26%)
MreC <178..>224 CDD:302802 16/45 (36%)
LTD 473..574 CDD:279300 13/56 (23%)
NeflNP_113971.1 Head 2..93 16/64 (25%)
Filament_head 9..88 CDD:282575 12/59 (20%)
Filament 89..400 CDD:278467 104/355 (29%)
Coil 1A 94..125 16/31 (52%)
Linker 1 126..138 2/11 (18%)
Coil 1B 139..234 32/136 (24%)
GBP_C <140..239 CDD:303769 33/142 (23%)
coiled coil 212..222 CDD:293879 3/9 (33%)
Linker 12 235..253 3/19 (16%)
Coil 2A 254..272 6/17 (35%)
Linker 2 273..281 2/7 (29%)
Coil 2B 282..397 35/114 (31%)
Epitope, recognized by IF-specific monoclonal antibody 382..392 7/9 (78%)
Tail 398..542 34/137 (25%)
Tail, subdomain A 398..444 16/55 (29%)
Tail, subdomain B (acidic) 445..542 18/80 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 451..542 16/74 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.