DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LamC and Lmntd1

DIOPT Version :9

Sequence 1:NP_001260974.1 Gene:LamC / 36615 FlyBaseID:FBgn0010397 Length:640 Species:Drosophila melanogaster
Sequence 2:XP_006507048.1 Gene:Lmntd1 / 74071 MGIID:1921321 Length:438 Species:Mus musculus


Alignment Length:191 Identity:40/191 - (20%)
Similarity:78/191 - (40%) Gaps:48/191 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   414 SGISSNGSHLTASASSRSGRVTPSGRRSATPGISGSSAVKRRR--------------------TV 458
            |.:||.|     ..:|:|..::.|.:.|:....|.||.|.||:                    ::
Mouse   108 STLSSRG-----QLASKSTILSCSHKDSSLGKQSTSSMVPRRQPQSSSDVDTYTFGNGEDYFLSL 167

  Fly   459 IDESEDRT--------LSEY---------SVNAAAKGDLEIIEADVEGRFIKLHNKGTE-EINLT 505
            ..||:..|        :||:         ...:::.|:::|.|.:::|.|::|.|...| |:.:.
Mouse   168 FGESKKLTAHTPQAENVSEHLSVILEEVGQFTSSSLGEIKIAEVNIKGLFVRLVNSSNEKEVEIG 232

  Fly   506 GWQLTR-IAGDEELAFKFSRGSKVLGGASVTIWSVDAGTAHDPPNNLVMKKKWPVANSMRS 565
            ...|.: :.|.....::|.....:...::||:|:..:.....||.:.|    |...:..||
Mouse   233 NHILQQNVNGHAVSLYQFPDNITLQANSTVTVWAAASEAKPQPPTDFV----WEEQSKFRS 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LamCNP_001260974.1 Filament 45..401 CDD:278467
ATP-synt_B <67..>142 CDD:304375
MreC <178..>224 CDD:302802
LTD 473..574 CDD:279300 21/95 (22%)
Lmntd1XP_006507048.1 LTD 204..309 CDD:376421 21/90 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0977
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.