DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LamC and Lmntd2

DIOPT Version :9

Sequence 1:NP_001260974.1 Gene:LamC / 36615 FlyBaseID:FBgn0010397 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_001334494.1 Gene:Lmntd2 / 72000 MGIID:1919250 Length:674 Species:Mus musculus


Alignment Length:600 Identity:117/600 - (19%)
Similarity:205/600 - (34%) Gaps:179/600 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 PVGGASTSSRVGATSPTSPTRTSRQQEKEELQHLNDRLACYIDRMRNLENENSRLTQELNLAQDT 84
            |.|....||.:|:...|...|.:....:....:.:..:.|.:.:               .||.:|
Mouse    18 PAGVQPDSSDLGSPVGTPVDRVAPSYSQSAKLYTSTPMGCSVKQ---------------QLAPET 67

  Fly    85 VNRETSNLKAVYEKELAAARKLLDETAKEKAKLEIDIKRLWEENDDLKPRLDKKTKEATVAENNA 149
            ::..|  |:.::|:.                :|||...|...:|.                 :||
Mouse    68 LDPRT--LRLLWEQR----------------ELEIQALRWAVQNG-----------------HNA 97

  Fly   150 RLYENRYNEVNGKYNQSL------------ADRKKFEDQAKELALENERLRRQLDDLRKQLEAET 202
            | |.:...||.|..::.|            :..|...:|.::|.||.:..:.|....::|||   
Mouse    98 R-YSSILQEVAGVPSERLRGMIAPPTRNSKSQDKFLRNQVQKLTLELKAQKEQAQQEKQQLE--- 158

  Fly   203 LARVDLENQNQSLREELAFKDQVHTQELTETRS-RRQIEISEIDGRLSRQYEAKLQQSLQE-LRD 265
                      :.|::.|..|.|:..:..|..:| ..|:..|...||:.|.....::....| |||
Mouse   159 ----------EKLQQNLWAKQQLEAELQTFQKSCLLQLARSSWVGRVLRSQTGSVEVVTTEVLRD 213

  Fly   266 QYEGQMRINREEIELLYDNEIQNLKAAANRAAQGSALATEEVRLMRTKIDGLNAKLQNLEDTNAG 330
            .                    .:...:|.....|.....|:|                  |.|:.
Mouse   214 P--------------------SDFSESAEIPTSGEGFPLEDV------------------DWNSI 240

  Fly   331 LNARIRELENLLDTERQRHNQYIAS----LEAELQRMRDEMAHQLQEYQG--LMDIKVSLDLEIA 389
            .........||.....|:.:|...|    |::|......|...::.|:..  |:|...|   |..
Mouse   241 AQRYPNLFSNLNFYSDQKQSQPPTSETYTLDSEGATKHTEKPTKILEWSALPLLDTSSS---ERT 302

  Fly   390 AYDKLLCGEERRLNIESPGRPTTDSGISSNGSHLTASASSRSGRVTPSGR-----RSATPGISGS 449
            ..|...|    .:.:.|..:.||  |..|.|::|.:|...:....:.||.     :|.:|..|  
Mouse   303 QSDTSSC----PIALHSGAKKTT--GHPSQGTNLASSEQMQEHTRSFSGYTEDLCKSHSPSCS-- 359

  Fly   450 SAVKRRRTVIDESED-------RTLSEYSVNAAAKGDLEIIEADVEGRFIKLHNKG-TEEINLTG 506
                  :||::...|       ..|:.:..      .|:|.......:||::.|:. .|.|:|.|
Mouse   360 ------KTVLESYTDLHHPYTRPQLNPFGC------CLKIAAVSHREKFIRVINQSQAETIDLGG 412

  Fly   507 WQLTRIAGDEELA-FKFSRGSKVLGGASVTIWSVDAGTAHDPPNNLVMKKKWPVAN--------S 562
            :.|.::..|..:. ::|..|:.:.....:|:|.  .||:.       .||:.|||:        |
Mouse   413 FVLQQLVRDFPVCMYRFPPGTLLAPQHHITVWG--EGTSR-------TKKQLPVASGQDPFQFQS 468

  Fly   563 MR---SVLANADKEV 574
            .|   :||.|...:|
Mouse   469 SRGCVTVLVNPQGQV 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LamCNP_001260974.1 Filament 45..401 CDD:278467 65/375 (17%)
ATP-synt_B <67..>142 CDD:304375 11/74 (15%)
MreC <178..>224 CDD:302802 10/45 (22%)
LTD 473..574 CDD:279300 27/113 (24%)
Lmntd2NP_001334494.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..40 7/21 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 255..282 6/26 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 296..339 12/51 (24%)
LTD 395..487 CDD:395746 25/97 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 514..573
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0977
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.