DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LamC and Iffo2

DIOPT Version :9

Sequence 1:NP_001260974.1 Gene:LamC / 36615 FlyBaseID:FBgn0010397 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_001128175.2 Gene:Iffo2 / 641315 RGDID:1624207 Length:512 Species:Rattus norvegicus


Alignment Length:490 Identity:92/490 - (18%)
Similarity:173/490 - (35%) Gaps:119/490 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 GGASTSSRVGATSPTSPTRTSRQQEKEELQHLNDRLACYIDRMRNLENENSRLTQELNLAQDTVN 86
            ||....:..|.:..|:..|.........|:.||.|..|::.::..||..|..|.::|...|...:
  Rat    26 GGGGGGAGPGPSPVTAALRDDLGSNIHLLKGLNVRFRCFLAKVHELERRNRLLEKQLEQQQSERD 90

  Fly    87 RETSNLKAVYEKELAAARKLLDETA-------------------------------KEKAKLE-- 118
            |.........|:.:....:||...|                               :...:|.  
  Rat    91 RRLRYKTFSREQAVQTGPELLRPPAAGGGQALGAATGVNANAVALGGLPPGGGSHPQHYGRLPGT 155

  Fly   119 ----IDIKRL--------------WEENDDLKPRLDKKTKEATVAENNARLYENRYNEVNGKYNQ 165
                ..::|.              |...|.:..::|..|.|.....|.....:...:|...::.:
  Rat   156 IWSYTQVRRTGGGGVETVQGPGVSWVHPDGVGVQIDTITPEIRALYNVLAKVKRERDEYKRRWEE 220

  Fly   166 SLA---DRKKFEDQAKELALENERLRRQLDDLRKQLEAE----------TLARVDLENQNQSLRE 217
            .||   :.:...|..:|.|.|.|.::.::::..::|:||          .:..:|.:.|.::::.
  Rat   221 ELAKCMNLQTMVDTLQEAAQEAEAIQEEMNEKIERLKAELVVFKGLMSDPMTDLDTKIQEKAMKV 285

  Fly   218 ELAFKDQVH-TQELTETRSRRQIE----------------------ISEIDGRLSRQYEAKLQQS 259
            ::....::. |.:|.:...:|..|                      |||.||.::|         
  Rat   286 DMDICRRIDITAKLCDVAQQRNSEDVSKIFQVVPKKKDRKVASDDDISEQDGEVNR--------- 341

  Fly   260 LQELRDQYEGQMRINREEIELL--------YDNEIQNLKAAANRAAQGSALATEEVRLMRTKIDG 316
               ..|:..|.|.|..|...:.        :|::..:|....|   :.:.|..|:.......|| 
  Rat   342 ---FSDEEVGSMNITDEMKRMFNQLRETFDFDDDCDSLTWEEN---EDTLLLWEDFTNCNPTID- 399

  Fly   317 LNAKLQNLEDTNAGLNARIRELENLLDTERQRHNQYIASLEAELQRMRDEMAHQLQEYQGLMDIK 381
                ||..::.|.|  ..|.|.|:...|..:.:.:.|..:|.||...:.:|...|.||..:..:|
  Rat   400 ----LQGEQEENLG--NLIHETESFFKTRDKEYQETIGQIELELATAKSDMNRHLHEYMEMCSMK 458

  Fly   382 VSLDLEIAAYDKLLCGEERRLNIESPGR-PTTDSG 415
            ..||:::....:|:.|...| |..||.. .::|||
  Rat   459 RGLDVQMETCRRLIKGSADR-NSPSPSSVASSDSG 492

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LamCNP_001260974.1 Filament 45..401 CDD:278467 80/450 (18%)
ATP-synt_B <67..>142 CDD:304375 17/125 (14%)
MreC <178..>224 CDD:302802 9/55 (16%)
LTD 473..574 CDD:279300
Iffo2NP_001128175.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.