DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LamC and Krt71

DIOPT Version :9

Sequence 1:NP_001260974.1 Gene:LamC / 36615 FlyBaseID:FBgn0010397 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_064340.1 Gene:Krt71 / 56735 MGIID:1861586 Length:524 Species:Mus musculus


Alignment Length:440 Identity:110/440 - (25%)
Similarity:199/440 - (45%) Gaps:74/440 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 RQQEKEELQHLNDRLACYIDRMRNLENENSRLTQELNLAQD-TVNRETSNLKAVYEKELAAARKL 106
            |.||:|:::.||::.|.:||::|.||.:|..|..:..|.|. .:|...:||:.:.|..::..||.
Mouse   128 RAQEREQIKALNNKFASFIDKVRFLEQQNQVLQTKWELLQQLDLNNCKNNLEPILEGHISNMRKQ 192

  Fly   107 LDETAKEKAKLEIDIKRLWEENDDLKPRLDKKTKEATVAENNARLYENRYNEVNGKYNQSLADRK 171
            |:..:.::.:|:.:::.:.:..:|.|.:.:::....|.|||                        
Mouse   193 LETLSGDRVRLDSELRNVRDVVEDYKKKYEEEINRRTAAEN------------------------ 233

  Fly   172 KFEDQAKELALENERLRRQLDDLRKQLEAETLARVDLENQNQSLREELAFKDQVHTQELTETRSR 236
                   |..|           |:|.::|....:|:|:.:..::.:::.|...:...|:.:.:| 
Mouse   234 -------EFVL-----------LKKDVDAAYANKVELQAKVDTMDQDIKFFKCLFEAEMAQIQS- 279

  Fly   237 RQIEISEIDGRLS--RQYEAKLQQSLQELRDQYEGQMRINREEIELLYDNEIQNLKAAANRAAQG 299
               .||::...||  ......|...:.|:|.|||.....::.|.|.||..:.|.|:.||.|....
Mouse   280 ---HISDMSVILSMDNNRNLDLDSIIDEVRAQYEEIALKSKAEAEALYQTKFQELQLAAGRHGDD 341

  Fly   300 SALATEEVRLMRTKIDGLNAKLQNLEDTNAGLNARIRELENLLDTERQRHNQYIASLEAELQRMR 364
            ......|:..:...|..|.::::|.:...:.|...|.:.|...|:..:.....:..||..|.:.:
Mouse   342 LKNTKNEITELTRFIQRLRSEIENAKKQASNLETAIADAEQRGDSALKDARAKLDELEGALHQAK 406

  Fly   365 DEMAHQLQEYQGLMDIKVSLDLEIAAYDKLLCGEERRLNIE--SP----------------GRPT 411
            :|:|..|:|||.||.:|::||:|||.|.|||..||.|::.|  ||                .||:
Mouse   407 EELARMLREYQELMSLKLALDMEIATYRKLLESEECRMSGEYSSPVSISIISSTSGSGGYGFRPS 471

  Fly   412 TDSG--ISSNGSHLTASASSRSGRVTPSGRRS-----ATPGISGSSAVKR 454
            |.||  ::::.|.::...|.|.|.....|..|     .|.|.|.|:..|:
Mouse   472 TVSGGYVANSTSCISGVCSVRGGENRSRGSASDYKDTLTKGSSLSTPSKK 521

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LamCNP_001260974.1 Filament 45..401 CDD:278467 89/358 (25%)
ATP-synt_B <67..>142 CDD:304375 16/75 (21%)
MreC <178..>224 CDD:302802 8/45 (18%)
LTD 473..574 CDD:279300
Krt71NP_064340.1 Head 1..130 1/1 (100%)
Keratin_2_head 15..127 CDD:292825
Filament 130..443 CDD:278467 89/358 (25%)
Coil 1A 131..166 12/34 (35%)
Linker 1 167..185 5/17 (29%)
Coil 1B 186..277 19/132 (14%)
Sec6 189..>424 CDD:303062 58/280 (21%)
Linker 12 278..301 6/26 (23%)
Coil 2 302..440 43/137 (31%)
Tail 441..524 21/81 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 493..524 8/29 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.