DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LamC and nefma

DIOPT Version :9

Sequence 1:NP_001260974.1 Gene:LamC / 36615 FlyBaseID:FBgn0010397 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_001104684.2 Gene:nefma / 553718 ZFINID:ZDB-GENE-050522-205 Length:849 Species:Danio rerio


Alignment Length:585 Identity:154/585 - (26%)
Similarity:250/585 - (42%) Gaps:132/585 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RRVTLNTRVSRASTST-----------------------PVGGASTSSRVGATSPTSPTRTS--- 42
            ||| ::||.|.:|.|:                       ||..|..|:.:.:......|:.|   
Zfish    13 RRV-MDTRTSYSSPSSGFRSQTWSRTSPSSSSYKRSFNVPVARAYGSAVLSSADSLDFTQNSIIN 76

  Fly    43 ----RQQEKEELQHLNDRLACYIDRMRNLENENSRLTQELN-LAQDTVNRETSNLKAVYEKELAA 102
                |..|||:||.||||.|.|||::..||.:|.::..|:. |.|..|::  |.|..:|::||..
Zfish    77 GDYKRSNEKEQLQGLNDRFAGYIDKVHFLEQQNQQIEAEIQALRQKQVSQ--SQLGELYDQELQE 139

  Fly   103 ARKLLDETAKEKAKLEIDIKRLWEENDDLKPRLDKKTKEATVAENNARLYENRYNEVNGKYNQSL 167
            .|.:|::|..|||::::|...:.|:...|:.|.|::          ||:.|              
Zfish   140 LRSMLEQTHHEKAQIQLDTDHIEEDIQRLRDRFDEE----------ARIRE-------------- 180

  Fly   168 ADRKKFEDQAKELALENERLRRQLDDLRKQLEAETLARVDLENQNQSLREELAFKDQVHTQELTE 232
                           |.|.:.|.   |:|.:....|.:.:||.:.|||::|:||....|.:|:::
Zfish   181 ---------------ETEAIVRA---LKKDMGDSALVKAELEKKVQSLQDEIAFIRNNHQEEISD 227

  Fly   233 TRSRRQIEISEIDGRLSRQYEAKLQQSLQELRDQYEGQMRINREEIELLYDNEIQNLKAAANRAA 297
            ..:  |::.|:|........:|.:..:|:|:|.|.||....|.:::|..:......|..||.:..
Zfish   228 LLA--QVQASQITVEKRDYQKADITDALREIRSQLEGHSTQNLQQVEDWFMCRYSKLTEAAEQNK 290

  Fly   298 QGSALATEEVRLMRTKIDGLNAKLQNLEDTNAGLNARIRELENLLDTERQRHNQYIAS------- 355
            .....|.:|:...|.::.....:|:::..|...|..::.::|:       |||..:||       
Zfish   291 SAIKSARDEISDYRRQLQSKTVELESVRGTKESLERQLNDIED-------RHNNDLASLQETIHQ 348

  Fly   356 LEAELQRMRDEMAHQLQEYQGLMDIKVSLDLEIAAYDKLLCGEERRLNIESPGRPTTDSG--ISS 418
            ||.||:..:.|||..|:|||.|:::|::||:|||||.|||.|||...: ..|.|.|...|  :.|
Zfish   349 LENELKSTKWEMARHLREYQDLLNVKMALDIEIAAYRKLLEGEESHFS-TFPYRQTVTKGPKVKS 412

  Fly   419 NGSHLTASASSRSGRVTPSGRRSATPGISGSSAVKRRRTVIDESEDRTLSEYSVNAAAKGDLEII 483
            ....|..             :......|...:.|:..::.:||:......|.|   |||.|.|..
Zfish   413 EPPKLKV-------------QHKFVEEIIEETRVEDEKSEMDEALAEMAEELS---AAKEDEEGG 461

  Fly   484 EADVEGRFIKLHNKGTEEINLTGWQLTRIAGDEELAFKFSRGSKVLGGASVTIWSVDAGTAHDPP 548
            |.:.|.      .:|.|            .||:|...|...|.   |.....:.|..|..|...|
Zfish   462 EEEGEA------EEGEE------------GGDDEEGEKEDEGE---GEEEEVVASTQAKVASAAP 505

  Fly   549  548
            Zfish   506  505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LamCNP_001260974.1 Filament 45..401 CDD:278467 108/363 (30%)
ATP-synt_B <67..>142 CDD:304375 23/75 (31%)
MreC <178..>224 CDD:302802 14/45 (31%)
LTD 473..574 CDD:279300 19/76 (25%)
nefmaNP_001104684.2 Filament_head 7..80 CDD:282575 14/67 (21%)
Filament 83..394 CDD:278467 108/363 (30%)
VAD1-2 <664..>739 CDD:291956
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.