DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LamC and NEFL

DIOPT Version :9

Sequence 1:NP_001260974.1 Gene:LamC / 36615 FlyBaseID:FBgn0010397 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_006149.2 Gene:NEFL / 4747 HGNCID:7739 Length:543 Species:Homo sapiens


Alignment Length:559 Identity:149/559 - (26%)
Similarity:237/559 - (42%) Gaps:113/559 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SARRVTLNTRVSRASTSTPVGGA-----STSSRVGATSP-------------TSPTRTSRQQEKE 48
            |.|......|.:.:|.|.||..:     |.||..|:..|             ::..::.|.|||.
Human    28 SVRSGYSTARSAYSSYSAPVSSSLSVRRSYSSSSGSLMPSLENLDLSQVAAISNDLKSIRTQEKA 92

  Fly    49 ELQHLNDRLACYIDRMRNLENENSRLTQELNLAQDTVNRETSNLKAVYEKELAAARKLLDETAKE 113
            :||.||||.|.:|:|:..||.:|..|..|| |.....:.|.|..:|:||:|:...|...::...|
Human    93 QLQDLNDRFASFIERVHELEQQNKVLEAEL-LVLRQKHSEPSRFRALYEQEIRDLRLAAEDATNE 156

  Fly   114 KAKLEIDIKRLWEENDDLKPRLDKKTKEATVAENNARLYENRYNEVNGKYNQSLADRKKFEDQAK 178
            |..|:       .|.:.|              |...|..:.||                     :
Human   157 KQALQ-------GEREGL--------------EETLRNLQARY---------------------E 179

  Fly   179 ELALENERLRRQLDDLRKQLEAETLARVDLENQNQSLREELAFKDQVHTQELTETRSRRQIEISE 243
            |..|..|....:|.:.||..:...|||.:||.:..||.:|::|..:||.:|:.|.::  ||:.::
Human   180 EEVLSREDAEGRLMEARKGADEAALARAELEKRIDSLMDEISFLKKVHEEEIAELQA--QIQYAQ 242

  Fly   244 IDGRLSRQYEAKLQQSLQELRDQYEGQMRINREEIELLYDNEIQNLKAAANRAAQGSALATEEVR 308
            |...:. ..:..|..:|:::|.|||.....|.:..|..:.:....|..:|.:.......|.:||.
Human   243 ISVEMD-VTKPDLSAALKDIRAQYEKLAAKNMQNAEEWFKSRFTVLTESAAKNTDAVRAAKDEVS 306

  Fly   309 LMRTKIDGLNAKLQNLEDTNAGLNARIRELENLLDTERQRHNQYIASLEAELQRMRDEMAHQLQE 373
            ..|..:.....:::.....|..|..:::|||:..:.:.......|..||.||:..:.|||..|:|
Human   307 ESRRLLKAKTLEIEACRGMNEALEKQLQELEDKQNADISAMQDTINKLENELRTTKSEMARYLKE 371

  Fly   374 YQGLMDIKVSLDLEIAAYDKLLCGEERRLNIESPGRPTTDSGISSNGSHLTASASSRSGRVTPSG 438
            ||.|:::|::||:|||||.|||.|||.||:..|.|..|              |..|:|.:|.   
Human   372 YQDLLNVKMALDIEIAAYRKLLEGEETRLSFTSVGSIT--------------SGYSQSSQVF--- 419

  Fly   439 RRSATPGISGSSAVKRRRT-----VIDESEDRTLSEYSVNAA----------AKGDLEIIEADVE 488
            .|||..|:..||.:...|:     .....|::...|.::.||          ::|:.|..|.|.|
Human   420 GRSAYGGLQTSSYLMSTRSFPSYYTSHVQEEQIEVEETIEAAKAEEAKDEPPSEGEAEEEEKDKE 484

  Fly   489 GRFIKLHNKGTEEINLTGWQLTRIAGDEELAFKFSRGSK 527
                    :..||         ..|.:||.|.:.|..:|
Human   485 --------EAEEE---------EAAEEEEAAKEESEEAK 506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LamCNP_001260974.1 Filament 45..401 CDD:278467 103/355 (29%)
ATP-synt_B <67..>142 CDD:304375 19/74 (26%)
MreC <178..>224 CDD:302802 15/45 (33%)
LTD 473..574 CDD:279300 15/65 (23%)
NEFLNP_006149.2 Head 2..92 15/63 (24%)
Filament_head 9..88 CDD:309741 12/59 (20%)
Filament 89..399 CDD:306535 103/355 (29%)
Coil 1A 93..124 15/31 (48%)
Linker 1 125..137 2/11 (18%)
Coil 1B 138..234 31/137 (23%)
Linker 12 235..252 3/19 (16%)
Coil 2A 253..271 6/17 (35%)
Linker 2 272..280 2/7 (29%)
Coil 2B 281..396 35/114 (31%)
Epitope, recognized by IF-specific monoclonal antibody 381..391 7/9 (78%)
Tail 397..543 34/144 (24%)
Tail, subdomain A 397..443 17/62 (27%)
Tail, subdomain B (acidic) 444..543 17/80 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 462..543 13/62 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.