DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LamC and KRT17

DIOPT Version :9

Sequence 1:NP_001260974.1 Gene:LamC / 36615 FlyBaseID:FBgn0010397 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_000413.1 Gene:KRT17 / 3872 HGNCID:6427 Length:432 Species:Homo sapiens


Alignment Length:436 Identity:121/436 - (27%)
Similarity:192/436 - (44%) Gaps:119/436 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 EKEELQHLNDRLACYIDRMRNLENENSRLTQELNLAQDTVNRETSNLKAVYE------KELAAAR 104
            ||..:|:||||||.|:|::|.||..|:.|..::   :|...|:.......|.      :||  ..
Human    84 EKATMQNLNDRLASYLDKVRALEEANTELEVKI---RDWYQRQAPGPARDYSQYYRTIEEL--QN 143

  Fly   105 KLLDETAKEKAKLEIDIKRLWEENDDLKPRLDKKTKEATVAENNARLYENRYNEVNGKYNQSLAD 169
            |:|..|.               :|.::..::|           ||||..:.:             
Human   144 KILTATV---------------DNANILLQID-----------NARLAADDF------------- 169

  Fly   170 RKKFE-DQAKELALENE--RLRRQLDDLRKQLEAETLARVDLENQNQSLREELAFKDQVHTQELT 231
            |.||| :||..|::|.:  .|||.||:|       ||||.|||.|.::|:||||:..:.|.:|:.
Human   170 RTKFETEQALRLSVEADINGLRRVLDEL-------TLARADLEMQIENLKEELAYLKKNHEEEMN 227

  Fly   232 ETRSRRQIEISEIDGRLSRQYEA----KLQQSLQELRDQYEGQMRINREEIELLYDNEIQNLKAA 292
            ..|       .::.|.::.:.:|    .|.:.|.|:|||||.....||::.|..:.::.:.|   
Human   228 ALR-------GQVGGEINVEMDAAPGVDLSRILNEMRDQYEKMAEKNRKDAEDWFFSKTEEL--- 282

  Fly   293 ANR-AAQGSAL---ATEEVRLMRTKIDGLNAKLQNLEDTNAGLNARIRELENLLDTERQRHNQYI 353
             || .|..|.|   ...|:..:|..:..|..:||:.....|.|...:.|.||....:..:....|
Human   283 -NREVATNSELVQSGKSEISELRRTMQALEIELQSQLSMKASLEGNLAETENRYCVQLSQIQGLI 346

  Fly   354 ASLEAELQRMRDEMAHQLQEYQGLMDIKVSLDLEIAAYDKLLCGEERRLNIESPGRPTTDSGISS 418
            .|:|.:|.::|.||..|.|||:.|:|:|..|:.|||.|.:||.||:                   
Human   347 GSVEEQLAQLRCEMEQQNQEYKILLDVKTRLEQEIATYRRLLEGED------------------- 392

  Fly   419 NGSHLTASASSRSGRVTPSGRRSATPGISGSSAVKRRRTVIDESED 464
              :|||   ..:...||                .::.||:::|.:|
Human   393 --AHLT---QYKKEPVT----------------TRQVRTIVEEVQD 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LamCNP_001260974.1 Filament 45..401 CDD:278467 112/371 (30%)
ATP-synt_B <67..>142 CDD:304375 14/80 (18%)
MreC <178..>224 CDD:302802 21/47 (45%)
LTD 473..574 CDD:279300
KRT17NP_000413.1 Head 1..83
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
Filament 84..394 CDD:365827 112/392 (29%)
Coil 1A 84..120 17/38 (45%)
Peptide epitope S1, induces T-cell and keratinocyte proliferation and IFN-gamma production 102..116 5/13 (38%)
Linker 1 121..138 2/16 (13%)
Coil 1B 139..230 40/138 (29%)
Peptide epitope S2, induces T-cell proliferation and IFN-gamma production 153..167 5/24 (21%)
Linker 12 231..250 2/18 (11%)
Coil 2 251..392 48/144 (33%)
Peptide epitope S4, induces T-cell and keratinocyte proliferation and IFN-gamma production 332..346 2/13 (15%)
Tail 393..432 9/44 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.