DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LamC and KRT16

DIOPT Version :9

Sequence 1:NP_001260974.1 Gene:LamC / 36615 FlyBaseID:FBgn0010397 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_005548.2 Gene:KRT16 / 3868 HGNCID:6423 Length:473 Species:Homo sapiens


Alignment Length:401 Identity:123/401 - (30%)
Similarity:181/401 - (45%) Gaps:73/401 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 EKEELQHLNDRLACYIDRMRNLENENSRLTQELNLAQDTVNRE-TSNLK--AVYEKELAAARKLL 107
            ||..:|:||||||.|:|::|.||..|:.|..::   :|...|: .|.:|  :.|.|.:...|..:
Human   117 EKVTMQNLNDRLASYLDKVRALEEANADLEVKI---RDWYQRQRPSEIKDYSPYFKTIEDLRNKI 178

  Fly   108 DETAKEKAK--LEIDIKRLWEENDDLKPRLDKKTKEATVAENNARLYENRYNEVNGKYNQSLADR 170
            .....|.|:  |:||                           ||||..:.:..   ||...||.|
Human   179 IAATIENAQPILQID---------------------------NARLAADDFRT---KYEHELALR 213

  Fly   171 KKFEDQAKELALENERLRRQLDDLRKQLEAETLARVDLENQNQSLREELAFKDQVHTQELTETRS 235
            :..|       .:...|||.||:|       ||||.|||.|.:.|:||||:..:.|.:|:...|.
Human   214 QTVE-------ADVNGLRRVLDEL-------TLARTDLEMQIEGLKEELAYLRKNHEEEMLALRG 264

  Fly   236 RR----QIEISEIDGRLSRQYEAKLQQSLQELRDQYEGQMRINREEIE--LLYDNEIQNLKAAAN 294
            :.    .:|:....|       ..|.:.|.|:|||||.....||.:.|  .|...|..|.:.|:|
Human   265 QTGGDVNVEMDAAPG-------VDLSRILNEMRDQYEQMAEKNRRDAETWFLSKTEELNKEVASN 322

  Fly   295 RAAQGSALATEEVRLMRTKIDGLNAKLQNLEDTNAGLNARIRELENLLDTERQRHNQYIASLEAE 359
            .....|  :..||..:|..:.||..:||:.....|.|...:.|.:.....:..:....|.|:|.:
Human   323 SELVQS--SRSEVTELRRVLQGLEIELQSQLSMKASLENSLEETKGRYCMQLSQIQGLIGSVEEQ 385

  Fly   360 LQRMRDEMAHQLQEYQGLMDIKVSLDLEIAAYDKLLCGEERRLNIESPGRPTTDSGISSNGSHLT 424
            |.::|.||..|.||||.|:|:|..|:.|||.|.:||.||:..|:.:..      ||.|.:...:.
Human   386 LAQLRCEMEQQSQEYQILLDVKTRLEQEIATYRRLLEGEDAHLSSQQA------SGQSYSSREVF 444

  Fly   425 ASASSRSGRVT 435
            .|:||.|.|.|
Human   445 TSSSSSSSRQT 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LamCNP_001260974.1 Filament 45..401 CDD:278467 113/365 (31%)
ATP-synt_B <67..>142 CDD:304375 16/79 (20%)
MreC <178..>224 CDD:302802 19/45 (42%)
LTD 473..574 CDD:279300
KRT16NP_005548.2 Head 1..116
Filament 116..427 CDD:278467 113/365 (31%)
Coil 1A 117..152 16/37 (43%)
Linker 1 153..170 4/16 (25%)
Coil 1B 171..262 37/134 (28%)
Zinc_peptidase_like <239..327 CDD:301362 27/94 (29%)
Linker 12 263..285 4/28 (14%)
Coil 2 286..424 48/139 (35%)
Tail 425..473 10/37 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 428..473 10/34 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.