DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LamC and si:dkey-222n6.2

DIOPT Version :9

Sequence 1:NP_001260974.1 Gene:LamC / 36615 FlyBaseID:FBgn0010397 Length:640 Species:Drosophila melanogaster
Sequence 2:XP_003199098.1 Gene:si:dkey-222n6.2 / 386799 ZFINID:ZDB-GENE-031118-10 Length:376 Species:Danio rerio


Alignment Length:428 Identity:114/428 - (26%)
Similarity:195/428 - (45%) Gaps:84/428 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SARRVTLNTRVSRASTS-------TPVGGASTSSRVGATSPTSPT--------RTSRQQEKEELQ 51
            |:|.|..|..:.|...|       .|..||........:|..:|.        :|.|.||.::::
Zfish     4 SSRSVGSNASIPRQGNSYFGFGNMMPASGAPIRPVSVNSSLLAPVDLQLDPELQTVRMQETQQMK 68

  Fly    52 HLNDRLACYIDRMRNLENENSRLTQELNLAQDTVNRETSNLKAVYEKELAAARKLLDETAKEKAK 116
            .||:|.|.:||::|.||.||                          |.|....:||.:..|.::|
Zfish    69 TLNNRFASFIDKVRKLEQEN--------------------------KLLETKWRLLQKETKAESK 107

  Fly   117 LEIDIKRLWEENDDLKPRLDKKTKEATVAENNARLYENRYNEVNGKYNQSLADRKKFEDQAKELA 181
            ||..:|..   :..|:.:|::..|:....:|..|....:..|...:|...:.:|.|.|:   ...
Zfish   108 LEPMLKNY---STSLQMQLERVKKDKEQLDNELRKAHAQVQEQKQRYEDEIGNRNKAEN---AFV 166

  Fly   182 LENERLRRQLDDLRKQLEAETLARVDLENQNQSLREELAFKDQVHTQELTETRSRRQIEISEIDG 246
            |           |:|.::...|.::.||.:.::::|||.|....:.|||.|.|.  :::.:.:..
Zfish   167 L-----------LKKDVDTTYLGKIALEEKLETIQEELNFFKSFYEQELEELRD--EVKDTSVVV 218

  Fly   247 RLSRQYEAKLQQSLQELRDQYEGQMRINREEIELLYDNEIQNLKAAANRAAQGSALATEEVRLMR 311
            ::.......:::.|.:::.|||.....:|.|.|..|.|:...:.:.||:       .:.|::..:
Zfish   219 QMDNSRNLNMEKILADVKSQYEEISACSRREAEAWYKNKFDLVSSQANQ-------CSTELKNNK 276

  Fly   312 TKIDGLNAKLQNLED--TNA-----GLNARIRELEN-----LLDTERQRHNQYIASLEAELQRMR 364
            ..||.|..|:|.|::  |:|     .:..:|:|.|.     :||...|     |..||..||:.:
Zfish   277 GAIDELKRKIQRLQNDITSAKSQCDNVEEKIKEAERDGEEAVLDATEQ-----IRLLEEALQKAK 336

  Fly   365 DEMAHQLQEYQGLMDIKVSLDLEIAAYDKLLCGEERRL 402
            .|||.||::||.||::|::||:|||.|.|||.|||.|:
Zfish   337 KEMARQLRDYQELMNLKLALDIEIATYKKLLEGEEDRI 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LamCNP_001260974.1 Filament 45..401 CDD:278467 100/367 (27%)
ATP-synt_B <67..>142 CDD:304375 16/74 (22%)
MreC <178..>224 CDD:302802 10/45 (22%)
LTD 473..574 CDD:279300
si:dkey-222n6.2XP_003199098.1 Keratin_2_head <23..59 CDD:292825 5/35 (14%)
Filament 62..373 CDD:278467 100/367 (27%)
crotonase-like 304..>347 CDD:304874 16/47 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.