DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LamC and KRT15

DIOPT Version :9

Sequence 1:NP_001260974.1 Gene:LamC / 36615 FlyBaseID:FBgn0010397 Length:640 Species:Drosophila melanogaster
Sequence 2:XP_011523086.1 Gene:KRT15 / 3866 HGNCID:6421 Length:463 Species:Homo sapiens


Alignment Length:414 Identity:119/414 - (28%)
Similarity:190/414 - (45%) Gaps:76/414 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 EKEELQHLNDRLACYIDRMRNLENENSRLTQELNLAQDTVNRETSNLK----AVYEKELAAARKL 106
            ||..:|:||||||.|:|::|.||..|:.|..:::   |...::|....    :.|.|.:...|..
Human   105 EKITMQNLNDRLASYLDKVRALEEANADLEVKIH---DWYQKQTPTSPECDYSQYFKTIEELRDK 166

  Fly   107 LDETAKEKAK--LEIDIKRLWEENDDLKPRLDKKTKEATVAENNARLYENRYNEVNGKYNQSLAD 169
            :..|..:.::  ||||..||..::..||            .||...|.:....::||        
Human   167 IMATTIDNSRVILEIDNARLAADDFRLK------------YENELALRQGVEADING-------- 211

  Fly   170 RKKFEDQAKELALENERLRRQLDDLRKQLEAETLARVDLENQNQSLREELAFKDQVHTQELTETR 234
                             |||.||:|       ||||.|||.|.:.|.||||:..:.|.:.:....
Human   212 -----------------LRRVLDEL-------TLARTDLEMQIEGLNEELAYLKKNHEEWVPPIL 252

  Fly   235 SRRQIEISEIDGRLSRQYEA----KLQQSLQELRDQYEGQMRINREEIELLYDNEIQ--NLKAAA 293
            ...:...|::.|:::.:.:|    .|.:.|.|:|:|||.....||.::|..:.::.:  |.:.|:
Human   253 QEMKEFSSQLAGQVNVEMDAAPGVDLTRVLAEMREQYEAMAEKNRRDVEAWFFSKTEELNKEVAS 317

  Fly   294 NRAAQGSALATEEVRLMRTKIDGLNAKLQNLE-------DTNAGLNARIRELENLLDTERQRHNQ 351
            |         ||.::..:|:|..|...:|.||       ...|||...:.|.|....|:.|:...
Human   318 N---------TEMIQTSKTEITDLRRTMQELEIELQSQLSMKAGLENSLAETECRYATQLQQIQG 373

  Fly   352 YIASLEAELQRMRDEMAHQLQEYQGLMDIKVSLDLEIAAYDKLLCGEERRLNIESPGRPTTDSGI 416
            .|..|||:|..:|.||..|.|||:.|:|||..|:.|||.|..||.|::.::...:....::..|.
Human   374 LIGGLEAQLSELRCEMEAQNQEYKMLLDIKTRLEQEIATYRSLLEGQDAKMAGIAIREASSGGGG 438

  Fly   417 SSNGSHLTASASSRSGRVTPSGRR 440
            ||:..|:... .|..|:|..|.:|
Human   439 SSSNFHINVE-ESVDGQVVSSHKR 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LamCNP_001260974.1 Filament 45..401 CDD:278467 110/373 (29%)
ATP-synt_B <67..>142 CDD:304375 18/80 (23%)
MreC <178..>224 CDD:302802 19/45 (42%)
LTD 473..574 CDD:279300
KRT15XP_011523086.1 Filament 104..423 CDD:278467 110/373 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.