DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LamC and KRT12

DIOPT Version :9

Sequence 1:NP_001260974.1 Gene:LamC / 36615 FlyBaseID:FBgn0010397 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_000214.1 Gene:KRT12 / 3859 HGNCID:6414 Length:494 Species:Homo sapiens


Alignment Length:475 Identity:118/475 - (24%)
Similarity:194/475 - (40%) Gaps:96/475 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 GGASTSSRVGATSPTSPTRTSRQQEKEELQHLNDRLACYIDRMRNLENENSRLTQELNLAQDTVN 86
            ||:.....:|..|.......| ..|||.:|:||||||.|:|::|.||..|:.|..::....:|..
Human   102 GGSPGGGSLGILSGNDGGLLS-GSEKETMQNLNDRLASYLDKVRALEEANTELENKIREWYETRG 165

  Fly    87 RETSNLKAVYEKELAAARKLLDETAKEKAKLEIDIKRLWEENDDLKPRLDKKTKEATVAE----- 146
            ..|::..                        :.|..:.:...:||:    .|...|::..     
Human   166 TGTADAS------------------------QSDYSKYYPLIEDLR----NKIISASIGNAQLLL 202

  Fly   147 --NNARLYENRYNEVNGKYNQSLADRKKFEDQAKELALENERLRRQLDDLRKQLEAETLARVDLE 209
              :||||....:             |.|:|:   |||| .:.:...::.||:.|:..||.|.|||
Human   203 QIDNARLAAEDF-------------RMKYEN---ELAL-RQGVEADINGLRRVLDELTLTRTDLE 250

  Fly   210 NQNQSLREELAFKDQVHTQELTETRSRRQIEIS-EIDGRLSRQYEAKLQQSLQELRDQYEGQMRI 273
            .|.:||.||||:..:.|..||...|.....|:| |:|....    ..|.:.|.::|.|||.....
Human   251 MQIESLNEELAYMKKNHEDELQSFRVGGPGEVSVEMDAAPG----VDLTRLLNDMRAQYETIAEQ 311

  Fly   274 NREEIELLYDNEIQNLKAAANRAAQGSALATEEVRLMRTKIDGLNAKLQNLEDTNAGLNARIREL 338
            ||::.|..:..:...|:...:...:....:..||..:|.....|..:||:.......|...:.|.
Human   312 NRKDAEAWFIEKSGELRKEISTNTEQLQSSKSEVTDLRRAFQNLEIELQSQLAMKKSLEDSLAEA 376

  Fly   339 ENLLDTERQRHNQYIASLEAELQRMRDEMAHQLQEYQGLMDIKVSLDLEIAAYDKLLCGEERRLN 403
            |.....:..:..|.|::|||:|.::|.:...|..::|.|:::|..|:|||..|.:||.||.:...
Human   377 EGDYCAQLSQVQQLISNLEAQLLQVRADAERQNVDHQRLLNVKARLELEIETYRRLLDGEAQGDG 441

  Fly   404 IESPGRPTTDSGISSNGSHLTASASSRSGRVTPSGRRSATPGISGSSAVKRRRTVIDESEDRTLS 468
            :|. ....|||         .:.|.|......|:..|             :.:||:.|       
Human   442 LEE-SLFVTDS---------KSQAQSTDSSKDPTKTR-------------KIKTVVQE------- 476

  Fly   469 EYSVNAAAKGDLEIIEADVE 488
              .||.      |::.:.|:
Human   477 --MVNG------EVVSSQVQ 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LamCNP_001260974.1 Filament 45..401 CDD:278467 98/363 (27%)
ATP-synt_B <67..>142 CDD:304375 10/74 (14%)
MreC <178..>224 CDD:302802 20/45 (44%)
LTD 473..574 CDD:279300 3/16 (19%)
KRT12NP_000214.1 Head 1..124 5/22 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..32
Filament 124..436 CDD:278467 96/360 (27%)
Coil 1A 125..160 17/34 (50%)
Linker 1 164..182 2/41 (5%)
Coil 1B 183..274 34/111 (31%)
Linker 12 275..297 6/25 (24%)
Coil 2 298..435 36/136 (26%)
Tail 436..494 16/91 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 446..468 6/30 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.