DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LamC and KRT8

DIOPT Version :9

Sequence 1:NP_001260974.1 Gene:LamC / 36615 FlyBaseID:FBgn0010397 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_001243211.1 Gene:KRT8 / 3856 HGNCID:6446 Length:511 Species:Homo sapiens


Alignment Length:507 Identity:136/507 - (26%)
Similarity:228/507 - (44%) Gaps:113/507 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SRASTSTPVGGASTS--SRVGAT--------------------------SPTSP--------TRT 41
            ||:.||.|....|:|  ||||::                          |..||        .:.
Human    50 SRSYTSGPGSRISSSSFSRVGSSNFRGGLGGGYGGASGMGGITAVTVNQSLLSPLVLEVDPNIQA 114

  Fly    42 SRQQEKEELQHLNDRLACYIDRMRNLENENSRLTQELNLAQDTVNRETSNLKAVYEKELAAARKL 106
            .|.||||:::.||::.|.:||::|.||.:|..|..:.:|.|.. ....||:..::|..:...|:.
Human   115 VRTQEKEQIKTLNNKFASFIDKVRFLEQQNKMLETKWSLLQQQ-KTARSNMDNMFESYINNLRRQ 178

  Fly   107 LDETAKEKAKLEIDIKRLWEENDDLKPRLDKKTKEATVAENNARLYENRY-NEVNGKYNQSLADR 170
            |:...:||.|||.::..:....:|.|                     |:| :|:|          
Human   179 LETLGQEKLKLEAELGNMQGLVEDFK---------------------NKYEDEIN---------- 212

  Fly   171 KKFEDQAKELALENERLRRQLDDLRKQLEAETLARVDLENQNQSLREELAFKDQVHTQELTETRS 235
                   |...:|||.:.     ::|.::...:.:|:||::.:.|.:|:.|..|::.:|:.|.:|
Human   213 -------KRTEMENEFVL-----IKKDVDEAYMNKVELESRLEGLTDEINFLRQLYEEEIRELQS 265

  Fly   236 RRQIEISEIDGRLSRQYEAKLQQS--LQELRDQYEGQMRINREEIELLYDNEIQNLKAAANRAAQ 298
                :||:....||......|...  :.|::.|||.....:|.|.|.:|..:.:.|::.|.:...
Human   266 ----QISDTSVVLSMDNSRSLDMDSIIAEVKAQYEDIANRSRAEAESMYQIKYEELQSLAGKHGD 326

  Fly   299 GSALATEEVRLMRTKIDGLNAKLQNLEDTNAGLNARIRELENLLDTERQRHNQYIASLEAELQRM 363
            .......|:..|...|..|.|:::.|:...|.|.|.|.:.|...:...:..|..::.|||.|||.
Human   327 DLRRTKTEISEMNRNISRLQAEIEGLKGQRASLEAAIADAEQRGELAIKDANAKLSELEAALQRA 391

  Fly   364 RDEMAHQLQEYQGLMDIKVSLDLEIAAYDKLLCGEERRLNIESPGRPTTDSGISSNGSHLTASAS 428
            :.:||.||:|||.||::|::||:|||.|.|||.|||.||          :||:.:...| |.:.|
Human   392 KQDMARQLREYQELMNVKLALDIEIATYRKLLEGEESRL----------ESGMQNMSIH-TKTTS 445

  Fly   429 SRSGRVTPSGRRSATPGIS-----------GSSAVKR----RRTVIDESEDR 465
            ..:|.::.:.....:||:|           |||:..|    |..|:.:.|.|
Human   446 GYAGGLSSAYGGLTSPGLSYSLGSSFGSGAGSSSFSRTSSSRAVVVKKIETR 497

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LamCNP_001260974.1 Filament 45..401 CDD:278467 102/358 (28%)
ATP-synt_B <67..>142 CDD:304375 18/74 (24%)
MreC <178..>224 CDD:302802 11/45 (24%)
LTD 473..574 CDD:279300
KRT8NP_001243211.1 Keratin_2_head <91..115 CDD:292825 3/23 (13%)
Filament 118..429 CDD:278467 102/358 (28%)
HAUS2 315..>404 CDD:291664 26/88 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.