DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LamC and KRT7

DIOPT Version :9

Sequence 1:NP_001260974.1 Gene:LamC / 36615 FlyBaseID:FBgn0010397 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_005547.3 Gene:KRT7 / 3855 HGNCID:6445 Length:469 Species:Homo sapiens


Alignment Length:506 Identity:128/506 - (25%)
Similarity:217/506 - (42%) Gaps:112/506 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 RASTSTPVG-GASTSSRVGATSPTSPTRTS---------------------------------RQ 44
            |.|::.|.| |:|:...:||:.|....|::                                 ||
Human    25 RLSSARPGGLGSSSLYGLGASRPRVAVRSAYGGPVGAGIREVTINQSLLAPLRLDADPSLQRVRQ 89

  Fly    45 QEKEELQHLNDRLACYIDRMRNLENENSRLTQELNLAQDTVNRETSNLKAVYEKELAAARKLLDE 109
            :|.|:::.||::.|.:||::|.||.:|..|..:..|.|:..:.::|.|..::|.::|..|..|:.
Human    90 EESEQIKTLNNKFASFIDKVRFLEQQNKLLETKWTLLQEQKSAKSSRLPDIFEAQIAGLRGQLEA 154

  Fly   110 TAKEKAKLEIDIKRLWEENDDLKPRLDKKTKEATVAENNARLYENRYNEVNGKYNQSLADRKKFE 174
            ...:..:||.:::.:.:..:|.|.:.:.:....|.|||                           
Human   155 LQVDGGRLEAELRSMQDVVEDFKNKYEDEINHRTAAEN--------------------------- 192

  Fly   175 DQAKELALENERLRRQLDDLRKQLEAETLARVDLENQNQSLREELAFKDQVHTQELTETRSRRQI 239
                |..:           |:|.::|..:::|:||.:..:|.:|:.|...::..||||.:|  ||
Human   193 ----EFVV-----------LKKDVDAAYMSKVELEAKVDALNDEINFLRTLNETELTELQS--QI 240

  Fly   240 EISEIDGRLSRQYEAKLQQSLQELRDQYEGQMRINREEIELLYDNEIQNLKAAANRAAQGSALAT 304
            ..:.:...:.......|...:.|::.|||...:.:|.|.|..|..:.:.|:|.|.:.........
Human   241 SDTSVVLSMDNSRSLDLDGIIAEVKAQYEEMAKCSRAEAEAWYQTKFETLQAQAGKHGDDLRNTR 305

  Fly   305 EEVRLMRTKIDGLNAKLQNLEDTNAGLNARIRELEN-----LLDTERQRHNQYIASLEAELQRMR 364
            .|:..|...|..|.|::.|:::..|.|.|.|.|.|.     |.|...::.     .|||.|||.:
Human   306 NEISEMNRAIQRLQAEIDNIKNQRAKLEAAIAEAEERGELALKDARAKQE-----ELEAALQRGK 365

  Fly   365 DEMAHQLQEYQGLMDIKVSLDLEIAAYDKLLCGEERRLNIESPGRPT----TDSGISSNGSHLTA 425
            .:||.||:|||.||.:|::||:|||.|.|||.|||.||..:..|...    ..:|.||:|..:..
Human   366 QDMARQLREYQELMSVKLALDIEIATYRKLLEGEESRLAGDGVGAVNISVMNSTGGSSSGGGIGL 430

  Fly   426 SASSRSGRVTPSGRRSATPGISGSSAVKRRRTVIDESEDRTLSEYSVNAAA 476
            :.....|....|...||.||:                    |..||:..|:
Human   431 TLGGTMGSNALSFSSSAGPGL--------------------LKAYSIRTAS 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LamCNP_001260974.1 Filament 45..401 CDD:278467 99/360 (28%)
ATP-synt_B <67..>142 CDD:304375 16/74 (22%)
MreC <178..>224 CDD:302802 10/45 (22%)
LTD 473..574 CDD:279300 1/4 (25%)
KRT7NP_005547.3 Keratin_2_head 1..87 CDD:292825 10/61 (16%)
Head 2..90 11/64 (17%)
DUF4081 <15..95 CDD:290051 14/69 (20%)
Filament 90..402 CDD:278467 99/360 (28%)
Coil 1A 90..126 12/35 (34%)
Interaction with HPV16 E7. /evidence=ECO:0000269|PubMed:12072504 92..97 1/4 (25%)
Linker 1 127..144 4/16 (25%)
Coil 1B 145..236 24/132 (18%)
Linker 12 237..260 4/24 (17%)
Coil 2 261..399 50/142 (35%)
Tail 400..469 18/82 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.