DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LamC and KRT6B

DIOPT Version :9

Sequence 1:NP_001260974.1 Gene:LamC / 36615 FlyBaseID:FBgn0010397 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_005546.2 Gene:KRT6B / 3854 HGNCID:6444 Length:564 Species:Homo sapiens


Alignment Length:448 Identity:122/448 - (27%)
Similarity:203/448 - (45%) Gaps:86/448 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 RQQEKEELQHLNDRLACYIDRMRNLENENSRLTQELNLAQD----TVNRETSNLKAVYEKELAAA 103
            |.:|:|:::.||::.|.:||::|.||.:|..|..:..|.|:    ||.:   ||:.::|:.:...
Human   160 RAEEREQIKTLNNKFASFIDKVRFLEQQNKVLDTKWTLLQEQGTKTVRQ---NLEPLFEQYINNL 221

  Fly   104 RKLLDETAKEKAKLEIDIKRLWEENDDLKPRLDKKTKEATVAENNARLYENRY-NEVNGKYNQSL 167
            |:.||....|:.:|:.:::.:.:..:|||                     |:| :|:|       
Human   222 RRQLDNIVGERGRLDSELRNMQDLVEDLK---------------------NKYEDEIN------- 258

  Fly   168 ADRKKFEDQAKELALENERLRRQLDDLRKQLEAETLARVDLENQNQSLREELAFKDQVHTQELTE 232
                      |..|.|||.:     .|:|.::|..:.:|:|:.:..:|.:|:.|...::..||  
Human   259 ----------KRTAAENEFV-----TLKKDVDAAYMNKVELQAKADTLTDEINFLRALYDAEL-- 306

  Fly   233 TRSRRQIEISEIDGRLS--RQYEAKLQQSLQELRDQYEGQMRINREEIELLYDNEIQNLKAAANR 295
              |:.|..||:....||  ......|...:.|::.|||...:.:|.|.|..|..:.:.|:..|.|
Human   307 --SQMQTHISDTSVVLSMDNNRNLDLDSIIAEVKAQYEEIAQRSRAEAESWYQTKYEELQITAGR 369

  Fly   296 AAQGSALATEEVRLMRTKIDGLNAKLQNLEDTNAGLNARIRELENLLDTERQRHNQYIASLEAEL 360
            .........:|:..:...|..|.:::.:::...|.|.|.|.:.|...:...:.....:..||..|
Human   370 HGDDLRNTKQEIAEINRMIQRLRSEIDHVKKQCANLQAAIADAEQRGEMALKDAKNKLEGLEDAL 434

  Fly   361 QRMRDEMAHQLQEYQGLMDIKVSLDLEIAAYDKLLCGEERRLNIESPG-------RPTTDSGIS- 417
            |:.:.::|..|:|||.||::|::||:|||.|.|||.|||.|||.|..|       :.|..||.. 
Human   435 QKAKQDLARLLKEYQELMNVKLALDVEIATYRKLLEGEECRLNGEGVGQVNISVVQSTVSSGYGG 499

  Fly   418 ----------------SNGSHLTASA--SSRSGRVTPSGRRSATPGISGSSAVKRRRT 457
                            |.||.|....  ||.|||.|..|..|..   .|||.:|...|
Human   500 ASGVGSGLGLGGGSSYSYGSGLGVGGGFSSSSGRATGGGLSSVG---GGSSTIKYTTT 554

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LamCNP_001260974.1 Filament 45..401 CDD:278467 96/362 (27%)
ATP-synt_B <67..>142 CDD:304375 19/78 (24%)
MreC <178..>224 CDD:302802 13/45 (29%)
LTD 473..574 CDD:279300
KRT6BNP_005546.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23
Head 2..162 1/1 (100%)
Keratin_2_head 17..159 CDD:318448
Filament 162..475 CDD:306535 96/362 (27%)
Coil 1A 163..198 12/34 (35%)
Linker 1 199..217 6/20 (30%)
Coil 1B 218..309 28/137 (20%)
Linker 12 310..333 6/22 (27%)
Coil 2 334..472 40/137 (29%)
Tail 473..564 26/85 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 533..564 9/25 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.