DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LamC and KRT5

DIOPT Version :9

Sequence 1:NP_001260974.1 Gene:LamC / 36615 FlyBaseID:FBgn0010397 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_000415.2 Gene:KRT5 / 3852 HGNCID:6442 Length:590 Species:Homo sapiens


Alignment Length:415 Identity:110/415 - (26%)
Similarity:189/415 - (45%) Gaps:56/415 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 RQQEKEELQHLNDRLACYIDRMRNLENENSRLTQELNLAQD----TVNRETSNLKAVYEKELAAA 103
            |.:|:|:::.||::.|.:||::|.||.:|..|..:..|.|:    ||.:   ||:.::|:.:...
Human   165 RTEEREQIKTLNNKFASFIDKVRFLEQQNKVLDTKWTLLQEQGTKTVRQ---NLEPLFEQYINNL 226

  Fly   104 RKLLDETAKEKAKLEIDIKRLWEENDDLKPRLDKKTKEATVAENNARLYENRYNEVNGKYNQSLA 168
            |:.||....|:.:|:.:::.:.:..:|.|.:.:.:..:.|.|||                     
Human   227 RRQLDSIVGERGRLDSELRNMQDLVEDFKNKYEDEINKRTTAEN--------------------- 270

  Fly   169 DRKKFEDQAKELALENERLRRQLDDLRKQLEAETLARVDLENQNQSLREELAFKDQVHTQELTET 233
                      |..:           |:|.::|..:.:|:||.:..:|.:|:.|.......||   
Human   271 ----------EFVM-----------LKKDVDAAYMNKVELEAKVDALMDEINFMKMFFDAEL--- 311

  Fly   234 RSRRQIEISEIDGRLS--RQYEAKLQQSLQELRDQYEGQMRINREEIELLYDNEIQNLKAAANRA 296
             |:.|..:|:....||  ......|...:.|::.|||.....:|.|.|..|..:.:.|:..|.|.
Human   312 -SQMQTHVSDTSVVLSMDNNRNLDLDSIIAEVKAQYEEIANRSRTEAESWYQTKYEELQQTAGRH 375

  Fly   297 AQGSALATEEVRLMRTKIDGLNAKLQNLEDTNAGLNARIRELENLLDTERQRHNQYIASLEAELQ 361
            .........|:..|...|..|.|::.|::...|.|...|.:.|...:...:.....:|.||..||
Human   376 GDDLRNTKHEISEMNRMIQRLRAEIDNVKKQCANLQNAIADAEQRGELALKDARNKLAELEEALQ 440

  Fly   362 RMRDEMAHQLQEYQGLMDIKVSLDLEIAAYDKLLCGEERRLNIESPGRPTTDSGISSNGSHLTAS 426
            :.:.:||..|:|||.||:.|::||:|||.|.|||.|||.||:.|..| |...|.::|:.|....|
Human   441 KAKQDMARLLREYQELMNTKLALDVEIATYRKLLEGEECRLSGEGVG-PVNISVVTSSVSSGYGS 504

  Fly   427 ASSRSGRVTPSGRRSATPGISGSSA 451
            .|...|.:..........|::|.|:
Human   505 GSGYGGGLGGGLGGGLGGGLAGGSS 529

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LamCNP_001260974.1 Filament 45..401 CDD:278467 95/361 (26%)
ATP-synt_B <67..>142 CDD:304375 18/78 (23%)
MreC <178..>224 CDD:302802 10/45 (22%)
LTD 473..574 CDD:279300
KRT5NP_000415.2 Head 1..167 1/1 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
Keratin_2_head 16..164 CDD:292825
Filament 167..480 CDD:278467 95/361 (26%)
Coil 1A 168..203 12/34 (35%)
Linker 1 204..222 6/20 (30%)
Coil 1B 223..315 24/137 (18%)
Linker 12 316..338 4/21 (19%)
Coil 2 339..477 44/137 (32%)
DUF883 393..>453 CDD:295076 16/59 (27%)
Tail 478..590 15/53 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 566..590
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.