DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LamC and KRT4

DIOPT Version :9

Sequence 1:NP_001260974.1 Gene:LamC / 36615 FlyBaseID:FBgn0010397 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_002263.3 Gene:KRT4 / 3851 HGNCID:6441 Length:520 Species:Homo sapiens


Alignment Length:472 Identity:122/472 - (25%)
Similarity:209/472 - (44%) Gaps:93/472 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 GASTSSRVGATSPTSPT------------------------RTSRQQEKEELQHLNDRLACYIDR 63
            |.|.|.:.|...|..|.                        :..|.:|:|:::.||::.|.:||:
Human    90 GGSFSGKGGPGFPVCPAGGIQEVTINQSLLTPLHVEIDPEIQKVRTEEREQIKLLNNKFASFIDK 154

  Fly    64 MRNLENENSRLTQELN-LAQDTVNRETSNLKAVYEKELAAARKLLDETAKEKAKLEIDIKRLWEE 127
            ::.||.:|..|..:.| |.|.|....:.||:.::|..|:..||.||....:|.:|:.::|.:.:.
Human   155 VQFLEQQNKVLETKWNLLQQQTTTTSSKNLEPLFETYLSVLRKQLDTLGNDKGRLQSELKTMQDS 219

  Fly   128 NDDLKPRLDKKTKEATVAENNARLYENRYNEVNGKYNQSLADRKKFEDQAKELALENERLRRQLD 192
            .:|.|.:.:::..:.|.|||:..:                                         
Human   220 VEDFKTKYEEEINKRTAAENDFVV----------------------------------------- 243

  Fly   193 DLRKQLEAETLARVDLENQNQSLREELAFKDQVHTQELTETRSRRQIEISEIDGRLS--RQYEAK 255
             |:|.::|..|.:|:||.:..||.:|:.|...::..||    |:.|..:|:....||  ......
Human   244 -LKKDVDAAYLNKVELEAKVDSLNDEINFLKVLYDAEL----SQMQTHVSDTSVVLSMDNNRNLD 303

  Fly   256 LQQSLQELRDQYEGQMRINREEIELLYDNEIQNLKAAANRAAQGSALATEEVRLMRTKIDGLNAK 320
            |...:.|:|.|||...:.::.|.|.||..::|.|:.:.::..........|:..:...|..|.|:
Human   304 LDSIIAEVRAQYEEIAQRSKAEAEALYQTKVQQLQISVDQHGDNLKNTKSEIAELNRMIQRLRAE 368

  Fly   321 LQNLEDTNAGLNARIRELEN-----LLDTERQRHNQYIASLEAELQRMRDEMAHQLQEYQGLMDI 380
            ::|::.....|...:.:.|.     |.|...:|     ..|||.||:.::|:|..|:|||.||.:
Human   369 IENIKKQCQTLQVSVADAEQRGENALKDAHSKR-----VELEAALQQAKEELARMLREYQELMSV 428

  Fly   381 KVSLDLEIAAYDKLLCGEERRLNIESPGRPTTD--SGISSNGSHLTASASSRSGRVTPSGRRSAT 443
            |::||:|||.|.|||.|||.|::.|.....:..  ||.:|.|. ::....|.||....||..|.:
Human   429 KLALDIEIATYRKLLEGEEYRMSGECQSAVSISVVSGSTSTGG-ISGGLGSGSGFGLSSGFGSGS 492

  Fly   444 -------PGISGSSAVK 453
                   ..:||||:.|
Human   493 GSGFGFGGSVSGSSSSK 509

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LamCNP_001260974.1 Filament 45..401 CDD:278467 98/363 (27%)
ATP-synt_B <67..>142 CDD:304375 21/75 (28%)
MreC <178..>224 CDD:302802 11/45 (24%)
LTD 473..574 CDD:279300
KRT4NP_002263.3 Head 1..136 7/45 (16%)
Keratin_2_head 14..133 CDD:406589 6/42 (14%)
Filament 136..449 CDD:365827 98/363 (27%)
Coil 1A 137..172 12/34 (35%)
Linker 1 173..191 5/17 (29%)
Coil 1B 192..284 28/137 (20%)
Linker 12 285..307 4/21 (19%)
Coil 2 308..447 45/143 (31%)
Tail 448..520 17/63 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 500..520 5/10 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.