DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LamC and KRT3

DIOPT Version :9

Sequence 1:NP_001260974.1 Gene:LamC / 36615 FlyBaseID:FBgn0010397 Length:640 Species:Drosophila melanogaster
Sequence 2:XP_024304743.1 Gene:KRT3 / 3850 HGNCID:6440 Length:716 Species:Homo sapiens


Alignment Length:393 Identity:110/393 - (27%)
Similarity:190/393 - (48%) Gaps:58/393 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 RQQEKEELQHLNDRLACYIDRMRNLENENSRLTQELNLAQDTVNRE---TSNLKAVYEKELAAAR 104
            :.||:|:::.||::.|.:||::|.||.:|..|..:.||.|......   |:||:.::|..:...|
Human   283 KAQEREQIKTLNNKFASFIDKVRFLEQQNKVLETKWNLLQQQGTSSISGTNNLEPLFENHINYLR 347

  Fly   105 KLLDETAKEKAKLEIDIKRLWEENDDLKPRLDKKTKEATVAENNARLYENRYNEVNGKYNQSLAD 169
            ..||....|:.:|:.::|.:.:..:|.|                                     
Human   348 SYLDNILGERGRLDSELKNMEDLVEDFK------------------------------------- 375

  Fly   170 RKKFEDQA-KELALENERLRRQLDDLRKQLEAETLARVDLENQNQSLREELAFKDQVHTQELTET 233
             ||:||:. |..|.|||.:     .|:|.:::..:.:|:|:.:..:|.:|:.|...::..||   
Human   376 -KKYEDEINKRTAAENEFV-----TLKKDVDSAYMNKVELQAKVDALIDEIDFLRTLYDAEL--- 431

  Fly   234 RSRRQIEISEIDGRLS--RQYEAKLQQSLQELRDQYEGQMRINREEIELLYDNEIQNLKAAANRA 296
             |:.|..||:....||  ......|...:.|:|.|||...:.::.|.|.||..::..|:..|.|.
Human   432 -SQMQSHISDTSVVLSMDNNRSLDLDSIIAEVRAQYEDIAQRSKAEAEALYQTKLGELQTTAGRH 495

  Fly   297 AQGSALATEEVRLMRTKIDGLNAKLQNLEDTNAGLNARIRELENLLDTERQRHNQYIASLEAELQ 361
            .........|:..:...|..|.|:::.::..||.|...|.|.|...:...:..|..:..|:|.||
Human   496 GDDLRNTKSEIIELNRMIQRLRAEIEGVKKQNANLQTAIAEAEQHGEMALKDANAKLQELQAALQ 560

  Fly   362 RMRDEMAHQLQEYQGLMDIKVSLDLEIAAYDKLLCGEERRLNIESPGRPTTDSGISSNGSHLTAS 426
            :.:|::|..|::||.||::|::||:|||.|.|||.|||.|::.|.|. ..:.|.:||:    |.|
Human   561 QAKDDLARLLRDYQELMNVKLALDVEIATYRKLLEGEEYRMSGECPS-AVSISVVSSS----TTS 620

  Fly   427 ASS 429
            ||:
Human   621 ASA 623

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LamCNP_001260974.1 Filament 45..401 CDD:278467 100/361 (28%)
ATP-synt_B <67..>142 CDD:304375 19/77 (25%)
MreC <178..>224 CDD:302802 12/45 (27%)
LTD 473..574 CDD:279300
KRT3XP_024304743.1 Keratin_2_head <258..282 CDD:318448
Filament 285..600 CDD:306535 100/361 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.