DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LamC and Krt19

DIOPT Version :9

Sequence 1:NP_001260974.1 Gene:LamC / 36615 FlyBaseID:FBgn0010397 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_955792.1 Gene:Krt19 / 360626 RGDID:619936 Length:403 Species:Rattus norvegicus


Alignment Length:412 Identity:119/412 - (28%)
Similarity:192/412 - (46%) Gaps:82/412 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 NTRVSRASTSTPVGGASTSSRVGATSPTSPTRTSRQQEKEELQHLNDRLACYIDRMRNLENENSR 73
            :||:..:|:...|||.. .|..||.:.|......  .||..:|:||||||.|:|::|.||..|..
  Rat    49 STRIVSSSSGGYVGGRG-GSFSGALTVTDGLLGG--NEKITMQNLNDRLASYLDKVRALEQANGE 110

  Fly    74 LTQELNLAQDTVNRETSNLKAVYEKELAAARKLLDETAKEKAKLEIDIKRLWEENDDLKPRLDKK 138
            |..:              ::..|:|:.....:              |..:.::..:||:.::...
  Rat   111 LEVK--------------IRDWYQKQGPGPFR--------------DYSQYFKTIEDLRDKILGA 147

  Fly   139 TKE---ATVAENNARLYENRYNEVNGKYNQSLADRKKFE-DQAKELALENE--RLRRQLDDLRKQ 197
            |.|   ..:..:||||..:.:             |.||| :||..:::|.:  .|||.||:|   
  Rat   148 TIENSKIVLQIDNARLAADDF-------------RTKFETEQALRMSVEADINGLRRVLDEL--- 196

  Fly   198 LEAETLARVDLENQNQSLREELAFKDQVHTQELTETRSRRQIEISEIDGRLSRQYEA----KLQQ 258
                ||||.|||.|.::|:||||:..:.|.:|::..|       |::.|::|.:.::    .|.:
  Rat   197 ----TLARTDLEMQIENLKEELAYLKKNHEEEISALR-------SQVGGQVSVEVDSTPGIDLAK 250

  Fly   259 SLQELRDQYEGQMRINREEIELLYDNEIQNLKAAANRAAQGSALATEEVRLMRTKIDGLNAKLQN 323
            .|.|:|.|||.....||::.|..|..:|..|....       |:.|.::::.:|::..|..|:|:
  Rat   251 ILSEMRSQYEAMAEKNRKDAEAWYLTQIDELNTQV-------AVHTTQIQINKTEVTELRRKVQD 308

  Fly   324 LE-------DTNAGLNARIRELENLLDTERQRHNQYIASLEAELQRMRDEMAHQLQEYQGLMDIK 381
            ||       ...|.|...:.|:|.....:.......|:|:|.:|..:|.:...|.||||.|||||
  Rat   309 LEIELQSQLSMKAALEGTVAEIEARYGAQLSHIQGVISSIEVQLSNVRADTERQNQEYQQLMDIK 373

  Fly   382 VSLDLEIAAYDKLLCGEERRLN 403
            ..|:.|||.|..||.|:|...|
  Rat   374 SRLEQEIATYRSLLEGQEAHYN 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LamCNP_001260974.1 Filament 45..401 CDD:278467 108/372 (29%)
ATP-synt_B <67..>142 CDD:304375 11/77 (14%)
MreC <178..>224 CDD:302802 20/47 (43%)
LTD 473..574 CDD:279300
Krt19NP_955792.1 Head 1..82 10/35 (29%)
Filament 82..393 CDD:278467 108/372 (29%)
Coil 1A 83..118 16/48 (33%)
Linker 1 119..136 3/30 (10%)
Coil 1B 137..228 36/110 (33%)
Linker 12 229..251 5/28 (18%)
Necessary for interaction with PNN. /evidence=ECO:0000250 247..393 49/152 (32%)
Coil 2 252..390 46/144 (32%)
Rod-like helical tail 391..403 2/5 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.