DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LamC and KRT79

DIOPT Version :9

Sequence 1:NP_001260974.1 Gene:LamC / 36615 FlyBaseID:FBgn0010397 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_787028.1 Gene:KRT79 / 338785 HGNCID:28930 Length:535 Species:Homo sapiens


Alignment Length:460 Identity:113/460 - (24%)
Similarity:207/460 - (45%) Gaps:101/460 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 RQQEKEELQHLNDRLACYIDRMRNLENENSRLTQELNLAQDT-----VNRETSNLKAVYEKELAA 102
            |.||:|:::.||::.|.:||::|.||.:|..|..:..|.|:.     |.|  :||:.::|..|.:
Human   139 RTQEREQIKTLNNKFASFIDKVRFLEQQNKVLETKWALLQEQGQNLGVTR--NNLEPLFEAYLGS 201

  Fly   103 ARKLLDETAKEKAKLEIDIKRLWEENDDLKPRLDKKTKEATVAENNARLYENRY-NEVNGKYNQS 166
            .|..||....|:.:|:.:::.:.:..:|.|                     |:| :|:|      
Human   202 MRSTLDRLQSERGRLDSELRNVQDLVEDFK---------------------NKYEDEIN------ 239

  Fly   167 LADRKKFEDQAKELALENERLRRQLDDLRKQLEAETLARVDLENQNQSLREELAFKDQVHTQELT 231
                       |..|.|||.:     .|:|.::|..:.|:||..:..:|.:|:.|..|::..||:
Human   240 -----------KHTAAENEFV-----VLKKDVDAAYMGRMDLHGKVGTLTQEIDFLQQLYEMELS 288

  Fly   232 ETR-------------SRRQIEISEIDGRLSRQYEAKLQQSLQELRDQYEGQMRINREEIELLYD 283
            :.:             :.|.:::..|...:..|||...|:|..|....|:.:.    ||:::...
Human   289 QVQTHVSNTNVVLSMDNNRNLDLDSIIAEVKAQYELIAQRSRAEAEAWYQTKY----EELQVTAG 349

  Fly   284 NEIQNLKAAANRAAQGSALATEEVRLMRTKIDGLNAKLQNLEDTNAGLNARIRELENLLDTERQR 348
            ....||:...|..|:    .|..::.::.:.|....:.|.|:...|....| .||. |.|.::: 
Human   350 KHGDNLRDTKNEIAE----LTRTIQRLQGEADAAKKQCQQLQTAIAEAEQR-GELA-LKDAQKK- 407

  Fly   349 HNQYIASLEAELQRMRDEMAHQLQEYQGLMDIKVSLDLEIAAYDKLLCGEERRLNIESPGRPTTD 413
                :..|:..|.:.::::...|::||.||::|::||:|||.|.|||..||.|::.|.|...:  
Human   408 ----LGDLDVALHQAKEDLTRLLRDYQELMNVKLALDVEIATYRKLLESEESRMSGECPSAVS-- 466

  Fly   414 SGISSNGSHLT---ASASSRSGRVTPSGRRSATPG---------------ISGSSAVKRRRTVID 460
              ||..|:..|   ..|:|..|.::..|...||.|               :|..:::.|:.|.:.
Human   467 --ISVTGNSTTVCGGGAASFGGGISLGGSGGATKGGFSTNVGYSTVKGGPVSAGTSILRKTTTVK 529

  Fly   461 ESEDR 465
            .|..|
Human   530 TSSQR 534

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LamCNP_001260974.1 Filament 45..401 CDD:278467 93/374 (25%)
ATP-synt_B <67..>142 CDD:304375 19/79 (24%)
MreC <178..>224 CDD:302802 14/45 (31%)
LTD 473..574 CDD:279300
KRT79NP_787028.1 Head 1..141 1/1 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..52
Keratin_2_head 30..138 CDD:292825
Filament 141..456 CDD:278467 93/374 (25%)
Coil 1A 142..177 12/34 (35%)
Linker 1 178..198 6/21 (29%)
Coil 1B 199..290 29/133 (22%)
Linker 12 291..314 1/22 (5%)
Coil 2 315..453 40/152 (26%)
Tail 454..535 20/85 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.