DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LamC and Krt4

DIOPT Version :9

Sequence 1:NP_001260974.1 Gene:LamC / 36615 FlyBaseID:FBgn0010397 Length:640 Species:Drosophila melanogaster
Sequence 2:XP_006242457.1 Gene:Krt4 / 315323 RGDID:1359272 Length:528 Species:Rattus norvegicus


Alignment Length:472 Identity:118/472 - (25%)
Similarity:207/472 - (43%) Gaps:96/472 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 GASTSSRVGATSPTSPT------------------------RTSRQQEKEELQHLNDRLACYIDR 63
            |.|.:.|.|...|..|.                        :..|..|:|:::.||::.|.:||:
  Rat    99 GGSFNGRGGPGFPVCPAGGIQEVTINQSLLTPLQVEIDPEIQKIRTAEREQIKTLNNKFASFIDK 163

  Fly    64 MRNLENENSRLTQELN-LAQDTVNRETSNLKAVYEKELAAARKLLDETAKEKAKLEIDIKRLWEE 127
            :|.||.:|..|..:.| |.|.|......||...:|..:.|.||.||..:.:|.:|:.::|.:.:.
  Rat   164 VRFLEQQNKVLETKWNLLQQQTTTTSPRNLDPFFETYINALRKNLDTLSNDKGRLQSELKLMQDS 228

  Fly   128 NDDLKPRLDKKTKEATVAENNARLYENRYNEVNGKYNQSLADRKKFEDQAKELALENERLRRQLD 192
            .:|.|.:.:::..:.|.|||:..:                                         
  Rat   229 VEDFKTKYEEEINKRTAAENDFVV----------------------------------------- 252

  Fly   193 DLRKQLEAETLARVDLENQNQSLREELAFKDQVHTQELTETRSRRQIEISEIDGRLSRQYEAKLQ 257
             |:|.::|..:.:|:||.:.:||::|:.|...::..||    |:.|..:|:....||......|.
  Rat   253 -LKKDVDAAYMIKVELEAKMESLKDEINFMRVLYEAEL----SQMQTHVSDTSVVLSMDNNRNLD 312

  Fly   258 QS--LQELRDQYEGQMRINREEIELLYDNEIQNLKAAANRAAQGSALATEEVRLMRTKIDGLNAK 320
            ..  :.|:|.|||...|.::.|:|..|..::|.|:.:|::..........|:..:...|..:.::
  Rat   313 LDGIIAEVRAQYEEIARKSKAEVESWYQIKVQQLQMSADQHGDSLKSTKNEISELNRMIQRIRSE 377

  Fly   321 LQNLEDTNAGLNARIRELEN-----LLDTERQRHNQYIASLEAELQRMRDEMAHQLQEYQGLMDI 380
            ::|::..:..|.|.:.:.|.     |.|...:|     |.||..||:.::::|..:::||.||::
  Rat   378 IENIKKQSQTLQASVADAEQRGELALKDAYTKR-----ADLETALQKAKEDLARLMRDYQELMNV 437

  Fly   381 KVSLDLEIAAYDKLLCGEERRLNIESPGRPTTDSGISSNGSHLTASASSRSGRVTPSGRRSAT-- 443
            |::||:|||.|.|||.|||.|::    |...:...||..|...:...|...|....||..|.:  
  Rat   438 KLALDVEIATYRKLLEGEECRMS----GECKSAVSISVVGGSASIGGSGGIGLGLGSGFGSGSCS 498

  Fly   444 -------PGISGSSAVK 453
                   .||.|||..|
  Rat   499 GSGFGFGGGIYGSSGTK 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LamCNP_001260974.1 Filament 45..401 CDD:278467 95/363 (26%)
ATP-synt_B <67..>142 CDD:304375 21/75 (28%)
MreC <178..>224 CDD:302802 10/45 (22%)
LTD 473..574 CDD:279300
Krt4XP_006242457.1 Keratin_2_head 14..142 CDD:292825 6/42 (14%)
Filament 146..458 CDD:278467 95/362 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.