DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LamC and Lmntd2

DIOPT Version :9

Sequence 1:NP_001260974.1 Gene:LamC / 36615 FlyBaseID:FBgn0010397 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_001121012.1 Gene:Lmntd2 / 309108 RGDID:1307439 Length:663 Species:Rattus norvegicus


Alignment Length:492 Identity:97/492 - (19%)
Similarity:186/492 - (37%) Gaps:145/492 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 TKEATVAEN---NARLYENRYNEVNGKYNQSLA-------------DRKKFEDQAKELALENERL 187
            |..|.||.:   :|:||.:  ..:|....|.||             ::::.|.||...|::|.:.
  Rat    34 TPVARVASSCPQSAKLYTS--TPMNCSVKQQLAPETLDPRTLRLLWEQRELEIQALRWAVQNGQN 96

  Fly   188 RRQLDDLRKQLEAETLARVDLENQNQSLREELAFKDQVH--TQELTETRSRRQIEISEIDGRLSR 250
            .|....|::.        ..:..:..|.|::...::||.  |.||...:.:.|.|        .:
  Rat    97 ARYYYILQEV--------AGIPPERNSKRQDKFLRNQVQKLTLELKAQKEQAQQE--------KQ 145

  Fly   251 QYEAKLQQSL---QELRDQYEGQMRINREEIELLYDNEIQNLKAAANRAAQGSALATEEVRLMRT 312
            |.|.||||:|   |:|                   :.|:|:.:.:.......|:.....:|....
  Rat   146 QLEEKLQQNLCAMQQL-------------------EAELQSFQKSCLLQLARSSWVGRTLRSQTG 191

  Fly   313 KIDGLNAK-LQNLEDT-------NAGLNARIRELE---------NLLDTERQRHNQYIASLEA-E 359
            .::.:.|: |:::.|:       |||...|:.:::         ||..:.....:|.::...| |
  Rat   192 SVEVVTAEVLRDVSDSSQCAEVPNAGEGFRLEDVDWNSIAHRYPNLFSSLSFHSDQKLSQPPASE 256

  Fly   360 LQRMRDEMAHQLQEYQGLMDIKVSLDLEIAAYDKLLCGEERRLNIESPGRPTTDSGISSNGSHLT 424
            :.....|.|.:..|       |.:..||.:|...          :::....:.:|.|||:...|.
  Rat   257 VDACDSECATKHTE-------KPTKTLEWSALPL----------VDTSSSESIESDISSSQMVLH 304

  Fly   425 ASASSRSGRVTPSGRRSATPGISGSSAVKR-RRTVIDESED-----------RTLSEYSVNAAAK 477
            :.|.:.:|. .|.|     |.::.|..::. .|:|...:||           ..|..|:      
  Rat   305 SGAKTTTGH-PPQG-----PNLAASEQMQECTRSVNGYTEDLHKSWSPSCSKTVLESYT------ 357

  Fly   478 GDLE----------------IIEADVEGRFIKLHNKG-TEEINLTGWQLTRIAGDEELA-FKFSR 524
             ||:                |.......:||::.|:. .|.::|.|:.|.::..|..:. ::|..
  Rat   358 -DLQHPYTRPQLNPFGCCLKIAAVSHREKFIRIINQSQAETVDLGGFVLQQLVRDFPVCMYRFPP 421

  Fly   525 GSKVLGGASVTIWSVDAGTAHDPPNNLVMKKKWPVAN 561
            |:.:.....:|:|.  .||:.       .||:.||::
  Rat   422 GTLLAPQHHITVWG--EGTSR-------TKKQLPVSS 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LamCNP_001260974.1 Filament 45..401 CDD:278467 59/300 (20%)
ATP-synt_B <67..>142 CDD:304375 1/2 (50%)
MreC <178..>224 CDD:302802 6/45 (13%)
LTD 473..574 CDD:279300 21/107 (20%)
Lmntd2NP_001121012.1 LTD 385..477 CDD:279300 18/74 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0977
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.