DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LamC and Krt73

DIOPT Version :9

Sequence 1:NP_001260974.1 Gene:LamC / 36615 FlyBaseID:FBgn0010397 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_001008808.2 Gene:Krt73 / 300248 RGDID:1359597 Length:539 Species:Rattus norvegicus


Alignment Length:475 Identity:113/475 - (23%)
Similarity:208/475 - (43%) Gaps:103/475 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SARRVTLNTRVSRASTSTPVGG-----------ASTSSRVGATSPTSPT---------------- 39
            |.|.::.|.    ||.|...||           |.:....||..|::|:                
  Rat    52 SPRSISFNV----ASGSGRTGGYGFGRNRASGFAGSMFGGGALGPSNPSLCLPGGIHQVTVNKSL 112

  Fly    40 ------------RTSRQQEKEELQHLNDRLACYIDRMRNLENENSRLTQELNLAQD-TVNRETSN 91
                        :..|.||:|:::.||::.|.:||::|.||.:|..|..:..|.|. .::....|
  Rat   113 LAPLNVELDPEIQKVRAQEREQIKALNNKFASFIDKVRFLEQQNQVLQTKWELLQQLDLSNCRRN 177

  Fly    92 LKAVYEKELAAARKLLDETAKEKAKLEIDIKRLWEENDDLKPRLDKKTKEATVAENNARLYENRY 156
            |:.|||..:::.:|.||..:.::.:|:.:::.:.:..:|.|.|.:::..:.|.|||         
  Rat   178 LEPVYEAHISSLQKQLDSLSGDRVRLDSELRGMRDAVEDCKKRYEEEINKRTTAEN--------- 233

  Fly   157 NEVNGKYNQSLADRKKFEDQAKELALENERLRRQLDDLRKQLEAETLARVDLENQNQSLREELAF 221
                                  |..:           |:|.::|..:::|:|:.:..:|..|:.|
  Rat   234 ----------------------EFVV-----------LKKDVDAAYMSKVELQAKVDALDGEIKF 265

  Fly   222 KDQVHTQELTETRSRRQIEISEIDGRLS--RQYEAKLQQSLQELRDQYEGQMRINREEIELLYDN 284
            ...::..|:|:.:|    .||:....||  ......|...:.|:|.|||.....::.|.|::|..
  Rat   266 LKCLYEGEITQMQS----HISDTSVVLSMDNNRNLDLDSIIAEVRAQYEDIALKSKAEAEMVYQT 326

  Fly   285 EIQNLKAAANRAAQGSALATEEVRLMRTKIDGLNAKLQNLEDTNAGLNARIRELENLLDTERQRH 349
            :.|.|:.||.|..........|:..:...|..|.:::::::...:.|...|.:.|...|...:..
  Rat   327 KFQELQLAAGRHGDDLKHTRNEISELTRLIQRLRSEIESVKKQCSNLETAIADAEQRGDCALKDA 391

  Fly   350 NQYIASLEAELQRMRDEMAHQLQEYQGLMDIKVSLDLEIAAYDKLLCGEERRLNIESPGRPTTDS 414
            ...:..||..|.:.::|:|..|:|:|.||.:|::||:|||.|.|||.|||.|:           |
  Rat   392 QAKLDDLERALHQAKEELARMLREHQELMSMKLALDIEIATYRKLLEGEECRM-----------S 445

  Fly   415 GISSNGSHLTASASSRSGRV 434
            |..:|...::..:||.:|.|
  Rat   446 GEHTNAVSISVISSSTTGAV 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LamCNP_001260974.1 Filament 45..401 CDD:278467 91/358 (25%)
ATP-synt_B <67..>142 CDD:304375 18/75 (24%)
MreC <178..>224 CDD:302802 9/45 (20%)
LTD 473..574 CDD:279300
Krt73NP_001008808.2 Head 1..130 14/81 (17%)
Keratin_2_head 15..127 CDD:406589 13/78 (17%)
Filament 130..443 CDD:365827 91/358 (25%)
Coil 1A 131..166 12/34 (35%)
Linker 1 167..185 6/17 (35%)
Coil 1B 186..277 22/132 (17%)
Linker 12 278..301 6/26 (23%)
Coil 2 302..440 40/137 (29%)
Tail 441..539 9/36 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.