DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LamC and GFAP

DIOPT Version :9

Sequence 1:NP_001260974.1 Gene:LamC / 36615 FlyBaseID:FBgn0010397 Length:640 Species:Drosophila melanogaster
Sequence 2:XP_024306458.1 Gene:GFAP / 2670 HGNCID:4235 Length:540 Species:Homo sapiens


Alignment Length:539 Identity:161/539 - (29%)
Similarity:244/539 - (45%) Gaps:89/539 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSARRVTLNTRVSRAST-STPVGGASTSSRVGATS--------PTSPTRT--------------S 42
            |..||:|...|.|..|: ...|||.:...|:|..:        |..|||.              :
Human     1 MERRRITSAARRSYVSSGEMMVGGLAPGRRLGPGTRLSLARMPPPLPTRVDFSLAGALNAGFKET 65

  Fly    43 RQQEKEELQHLNDRLACYIDRMRNLENENSRLTQELNLAQDTVNRETSNLKAVYEKELAAARKLL 107
            |..|:.|:..||||.|.||:::|.||.:|..|..|||..:   .:|.:.|..||:.||...|..|
Human    66 RASERAEMMELNDRFASYIEKVRFLEQQNKALAAELNQLR---AKEPTKLADVYQAELRELRLRL 127

  Fly   108 DETAKEKAKLEIDIKRLWEENDDLKPRLDKKTKEATVAENNARLYENRYNEVNGK---------- 162
            |:.....|:||::...|.::...::.:|..:|.....||||...| .:..||.|:          
Human   128 DQLTANSARLEVERDNLAQDLATVRQKLQDETNLRLEAENNLAAY-RQVREVEGRGRGGRKGLMA 191

  Fly   163 YNQSLADRKKFEDQAKELALENERLRRQLDDLRKQ---------------LEAE--TLARVDLEN 210
            .:.:.|.:....:|.........|.:.:|.:..|:               .||:  ||||:|||.
Human   192 THPNTAPKLSPPEQCAAPHCPRRRGKARLRNGEKEPGAPVALYSSPLLPLQEADEATLARLDLER 256

  Fly   211 QNQSLREELAFKDQVH---TQELTETRSRRQIEISEIDGRLSRQYEAK--LQQSLQELRDQYEGQ 270
            :.:||.||:.|..::|   .:||.|..:|:|:.: |:|       .||  |..:|:|:|.|||..
Human   257 KIESLEEEIRFLRKIHEEEVRELQEQLARQQVHV-ELD-------VAKPDLTAALKEIRTQYEAM 313

  Fly   271 MRINREEIELLYDNEIQNLKAAANRAAQGSALATEEVRLMRTKIDGLNAKLQNLEDTNAGLNARI 335
            ...|..|.|..|.::..:|..||.|.|:....|..|....|.::..|...|::|..||..|..::
Human   314 ASSNMHEAEEWYRSKFADLTDAAARNAELLRQAKHEANDYRRQLQSLTCDLESLRGTNESLERQM 378

  Fly   336 RELENLLDTERQRHNQYIASLEAELQRMRDEMAHQLQEYQGLMDIKVSLDLEIAAYDKLLCGEER 400
            ||.|.....|...:.:.:|.||.|.|.::||||..|||||.|:::|::||:|||.|.|||.|||.
Human   379 REQEERHVREAASYQEALARLEEEGQSLKDEMARHLQEYQDLLNVKLALDIEIATYRKLLEGEEN 443

  Fly   401 RL--------NIESPGRPTTDSGISSNGSHLTASASSRSGRV-----------TPSGRRSATPGI 446
            |:        |::..|..:|..|   ....:|....|.:.||           ||..|.::....
Human   444 RITIPVQTFSNLQIRGGKSTKDG---ENHKVTRYLKSLTIRVIPIQAHQIVNGTPPARETSLDTK 505

  Fly   447 SGSSAVKRRRTVIDESEDR 465
            |.|....:|..|:...|.|
Human   506 SVSEGHLKRNIVVKTVEMR 524

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LamCNP_001260974.1 Filament 45..401 CDD:278467 126/387 (33%)
ATP-synt_B <67..>142 CDD:304375 22/74 (30%)
MreC <178..>224 CDD:302802 17/62 (27%)
LTD 473..574 CDD:279300
GFAPXP_024306458.1 Filament_head 4..66 CDD:309741 15/61 (25%)
Filament 68..444 CDD:306535 126/387 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.