DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LamC and Nefm

DIOPT Version :9

Sequence 1:NP_001260974.1 Gene:LamC / 36615 FlyBaseID:FBgn0010397 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_058725.1 Gene:Nefm / 24588 RGDID:3160 Length:845 Species:Rattus norvegicus


Alignment Length:566 Identity:141/566 - (24%)
Similarity:229/566 - (40%) Gaps:166/566 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RRVT-LNTRVSRASTSTPVGGASTSSRVGATSPTSPT---------------------------- 39
            |||| ..:..||.|.|...|..|.|...|:.|..|.:                            
  Rat    15 RRVTETPSSFSRVSGSPSSGFRSQSWSRGSPSTVSSSYKRSALAPRLAYSSAMLSSAESSLDFSQ 79

  Fly    40 -------------RTSRQQEKEELQHLNDRLACYIDRMRNLENENSRLTQELN-LAQDTVNRETS 90
                         :.||..|||:||.||||.|.||:::..||.:|..:..|:: |.|...:.  :
  Rat    80 SSSLLNGGSGGDYKLSRSNEKEQLQGLNDRFAGYIEKVHYLEQQNKEIEAEIHALRQKQASH--A 142

  Fly    91 NLKAVYEKELAAARKLLDETAKEKAKLEIDIKRLWEENDDLKPRLDKKTKEATVAENNARLYENR 155
            .|...|::|:...|..|:....|||::::|...|.|:...||.|                     
  Rat   143 QLGDAYDQEIRELRATLEMVNHEKAQVQLDSDHLEEDIHRLKER--------------------- 186

  Fly   156 YNEVNGKYNQSLADRKKFEDQAKELALENERLRRQLDD-------LRKQLEAETLARVDLENQNQ 213
                             ||::|        |||   ||       |||.:|..::.:|:|:.:.|
  Rat   187 -----------------FEEEA--------RLR---DDTEAAIRALRKDIEESSMVKVELDKKVQ 223

  Fly   214 SLREELAFKDQVHTQELTETRSRRQIEISEIDGRLSRQYEAKLQQSLQELRDQYEGQMRINREEI 278
            ||::|:||....|.:|:.:..:  ||:.|.|........:..:..:|:|:|.|.|.....|..:.
  Rat   224 SLQDEVAFLRSNHEEEVADLLA--QIQASHITVERKDYLKTDISTALKEIRSQLECHSDQNMHQA 286

  Fly   279 ELLYDNEIQNLKAAANRAAQGSALATEEVRLMRTKIDGLNAKLQNLEDTNAGLNARIRELENLLD 343
            |..:......|..||.:..:....|.||:...|.::...:.:|:::..|...|..::.::|    
  Rat   287 EEWFKCRYAKLTEAAEQNKEAIRSAKEEIAEYRRQLQSKSIELESVRGTKESLERQLSDIE---- 347

  Fly   344 TERQRHNQYIAS-------LEAELQRMRDEMAHQLQEYQGLMDIKVSLDLEIAAYDKLLCGEERR 401
               :|||..::|       ||.||:..:.|||..|:|||.|:::|::||:|||||.|||.|||.|
  Rat   348 ---ERHNHDLSSYQDTIQQLENELRGTKWEMARHLREYQDLLNVKMALDIEIAAYRKLLEGEETR 409

  Fly   402 LNIESPGRPTTDSGISSNGSHLTASASSRSGRVTPSGRRSATPGISGSSAVKRRRT--------- 457
            .                         |:.||.:|........|.::.||.:::.:.         
  Rat   410 F-------------------------STFSGSITGPLYTHRQPSVTISSKIQKTKVEAPKLKVQH 449

  Fly   458 -----VIDES--EDR--------TLSEYSVNAAAKGDLEIIEADVE 488
                 :|:|:  ||.        |:....:.|:||.:.|..|...|
  Rat   450 KFVEEIIEETKVEDEKSEMEDALTVIAEELAASAKEEKEEAEEKEE 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LamCNP_001260974.1 Filament 45..401 CDD:278467 106/370 (29%)
ATP-synt_B <67..>142 CDD:304375 20/75 (27%)
MreC <178..>224 CDD:302802 17/52 (33%)
LTD 473..574 CDD:279300 6/16 (38%)
NefmNP_058725.1 Filament_head 10..97 CDD:282575 15/81 (19%)
Filament 98..409 CDD:278467 106/370 (29%)
Coil 1A 103..134 13/30 (43%)
Linker 1 135..147 2/13 (15%)
Coil 1B 148..246 35/148 (24%)
Linker 12 247..263 3/15 (20%)
Coil 2A 264..285 6/20 (30%)
Linker 2 286..289 1/2 (50%)
Coil 2B 290..410 41/126 (33%)
Tail 411..844 18/85 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 482..782 5/14 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.