DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LamC and Ina

DIOPT Version :9

Sequence 1:NP_001260974.1 Gene:LamC / 36615 FlyBaseID:FBgn0010397 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_062001.2 Gene:Ina / 24503 RGDID:2911 Length:506 Species:Rattus norvegicus


Alignment Length:513 Identity:138/513 - (26%)
Similarity:232/513 - (45%) Gaps:98/513 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 TRVSRASTSTPVGGASTSSRVG------------------ATSPTSPTRTSRQQEKEELQHLNDR 56
            :|.:.|||:    ..|::|.:|                  |.:.|:..:..|..|||:||.||||
  Rat    44 SRSNVASTA----ACSSASSLGLGLAYRRLPASDGLDLSQAAARTNEYKIIRTNEKEQLQGLNDR 104

  Fly    57 LACYIDRMRNLENENSRLTQELNLAQDTVNRETSNLKAVYEKELAAARKLLDETAKEKAKLEIDI 121
            .|.:|:::..||.:|..|..||...:.. :.|.|.:..::::||...|..|:|.:..:|:..::.
  Rat   105 FAVFIEKVHQLETQNRALEAELAALRQR-HAEPSRVGELFQRELRELRAQLEEASSARAQALLER 168

  Fly   122 KRLWEENDDLKPRLDKKTKEATVAENNARLYENRYNEVNGKYNQSLADRKKFEDQAKELALENER 186
            ..|.||...|:.|.:::::....||                                        
  Rat   169 DGLAEEVQRLRARCEEESRGREGAE---------------------------------------- 193

  Fly   187 LRRQLDDLRKQLEAETLARVDLENQNQSLREELAFKDQVHTQELTETRSRRQIE---ISEIDGRL 248
              |.|...::.::..||||:|||.:.:||.:||||..|||.:|:.|..:..|..   .:|:|..:
  Rat   194 --RALKAQQRDVDGATLARLDLEKKVESLLDELAFVRQVHDEEVAELLATLQASSQAAAEVDVAV 256

  Fly   249 SRQYEAKLQQSLQELRDQYEGQMRINREEIELLYDNEIQNLKAAANRAAQGSALATEEVRLMRTK 313
            ::   ..|..:|:|:|.|||.....|.:..|..|.::..||...|.|:.:....:.||:...|.:
  Rat   257 AK---PDLTSALREIRAQYESLAAKNLQSAEEWYKSKFANLNEQAARSTEAIRASREEIHEYRRQ 318

  Fly   314 IDGLNAKLQNLEDTNAGLNARIRELENLLDTERQRHNQYIASLEAELQRMRDEMAHQLQEYQGLM 378
            :.....:::.|...|..|..:|.|||.....|...:...|..||::|:..:.|||..|:|||.|:
  Rat   319 LQARTIEIEGLRGANESLERQILELEERHSAEVAGYQDSIGQLESDLRNTKSEMARHLREYQDLL 383

  Fly   379 DIKVSLDLEIAAYDKLLCGEERRLNIESPGRPTTDSGISSNG-------SHLTAS--ASSRSGRV 434
            ::|::||:|||||.|||.|||.|.         :.||:|.:|       |:|...  .||.:.:|
  Rat   384 NVKMALDIEIAAYRKLLEGEETRF---------STSGLSISGLNPLPNPSYLLPPRILSSTTSKV 439

  Fly   435 TPSG--------RRSATPGISGSSAVKRRRTVIDESEDRTLSEYSVNAAAKGDLEIIE 484
            :.:|        ..........|..|.::.:.:.||.:.||.| :|.:..|.:...||
  Rat   440 SSAGLSLKKEEEEEEEEEEEGASKEVTKKTSKVGESFEETLEE-TVVSTKKTEKSTIE 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LamCNP_001260974.1 Filament 45..401 CDD:278467 106/358 (30%)
ATP-synt_B <67..>142 CDD:304375 19/74 (26%)
MreC <178..>224 CDD:302802 15/45 (33%)
LTD 473..574 CDD:279300 3/12 (25%)
InaNP_062001.2 Head 1..87 9/46 (20%)
Filament_head 10..92 CDD:282575 9/51 (18%)
Coil 1A 88..129 18/40 (45%)
Filament 93..406 CDD:278467 106/358 (30%)
Linker 1 130..142 2/12 (17%)
Coil 1B 143..238 32/136 (24%)
Linker 2 239..262 3/25 (12%)
Coil 2 263..408 51/153 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.