DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LamC and Gfap

DIOPT Version :9

Sequence 1:NP_001260974.1 Gene:LamC / 36615 FlyBaseID:FBgn0010397 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_058705.2 Gene:Gfap / 24387 RGDID:2679 Length:430 Species:Rattus norvegicus


Alignment Length:431 Identity:134/431 - (31%)
Similarity:204/431 - (47%) Gaps:81/431 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSARRVTLNTRVSRASTSTPVGGASTSSRVGA--------TSPTSPTRT--------------SR 43
            |..||:| :.|.|.||:.|.|.|...:..:|.        .:|..|.|.              :|
  Rat     1 MERRRIT-SARRSYASSETMVRGHGPTRHLGTIPRLSLSRMTPPLPARVDFSLAGALNAGFKETR 64

  Fly    44 QQEKEELQHLNDRLACYIDRMRNLENENSRLTQELNLAQDTVNRETSNLKAVYEKELAAARKLLD 108
            ..|:.|:..||||.|.||:::|.||.:|..|..|||..:   .:|.:.|..||:.||...|..||
  Rat    65 ASERAEMMELNDRFASYIEKVRFLEQQNKALAAELNQLR---AKEPTKLADVYQAELRELRLRLD 126

  Fly   109 ETAKEKAKLEIDIKRLWEENDDLKPRLDKKTKEATVAENNARLYENRYNEVNGKYNQSLADRKKF 173
            :.....|:||::...|.::...|:.:|..:|.....||||..:|                     
  Rat   127 QLTTNSARLEVERDNLTQDLGTLRQKLQDETNLRLEAENNLAVY--------------------- 170

  Fly   174 EDQAKELALENERLRRQLDDLRKQLEAETLARVDLENQNQSLREELAFKDQVH---TQELTETRS 235
                                 |::.:..||||||||.:.:||.||:.|..::|   .:||.|..:
  Rat   171 ---------------------RQEADEATLARVDLERKVESLEEEIQFLRKIHEEEVRELQEQLA 214

  Fly   236 RRQIEISEIDGRLSRQYEAK--LQQSLQELRDQYEGQMRINREEIELLYDNEIQNLKAAANRAAQ 298
            ::|:.: |:|       .||  |..:|:|:|.|||.....|.:|.|..|.::..:|...|:|.|:
  Rat   215 QQQVHV-EMD-------VAKPDLTAALREIRTQYEAVATSNMQETEEWYRSKFADLTDVASRNAE 271

  Fly   299 GSALATEEVRLMRTKIDGLNAKLQNLEDTNAGLNARIRELENLLDTERQRHNQYIASLEAELQRM 363
            ....|..|....|.::..|...|::|..||..|..::||.|.....|...:.:.:|.||.|.|.:
  Rat   272 LLRQAKHEANDYRRQLQALTCDLESLRGTNESLERQMREQEERHARESASYQEALARLEEEGQSL 336

  Fly   364 RDEMAHQLQEYQGLMDIKVSLDLEIAAYDKLLCGEERRLNI 404
            ::|||..|||||.|:::|::||:|||.|.|||.|||.|:.|
  Rat   337 KEEMARHLQEYQDLLNVKLALDIEIATYRKLLEGEENRITI 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LamCNP_001260974.1 Filament 45..401 CDD:278467 116/360 (32%)
ATP-synt_B <67..>142 CDD:304375 23/74 (31%)
MreC <178..>224 CDD:302802 14/45 (31%)
LTD 473..574 CDD:279300
GfapNP_058705.2 Head 1..70 17/69 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31 11/30 (37%)
Filament_head 4..64 CDD:282575 14/60 (23%)
Filament 66..374 CDD:278467 116/360 (32%)
Coil 1A 71..102 15/30 (50%)
Linker 1 103..113 2/12 (17%)
Coil 1B 114..212 35/139 (25%)
Linker 12 213..228 5/22 (23%)
Coil 2A 229..250 8/20 (40%)
Linker 2 251..254 1/2 (50%)
Coil 2B 255..375 45/119 (38%)
Tail 376..430 1/2 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.