DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LamC and Krt90

DIOPT Version :9

Sequence 1:NP_001260974.1 Gene:LamC / 36615 FlyBaseID:FBgn0010397 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_808385.2 Gene:Krt90 / 239673 MGIID:3045312 Length:538 Species:Mus musculus


Alignment Length:432 Identity:119/432 - (27%)
Similarity:199/432 - (46%) Gaps:67/432 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 RQQEKEELQHLNDRLACYIDRMRNLENENSRLTQELNLAQDTVNRETSNLKAVYEKELAAARKLL 107
            |::|||:::.||::.|.:||::|.||.:|..|..:.:|.|:.....| ||:.::|..:...|:.|
Mouse   140 RKEEKEQIKTLNNKFASFIDKVRFLEQQNKVLETKWSLLQEHKTTRT-NLEPMFEAYITNLRRQL 203

  Fly   108 DETAKEKAKLEIDIKRLWEENDDLKPRLDKKTKEATVAENNARLYENRYNEVNGKYNQSLADRKK 172
            :....|:::||.::|.:.:..:|.|.:.:::....|.|||                         
Mouse   204 ECLGGERSRLETELKSMQDVVEDFKNKYEEEIHRRTAAEN------------------------- 243

  Fly   173 FEDQAKELALENERLRRQLDDLRKQLEAETLARVDLENQNQSLREELAFKDQVHTQELTETRSRR 237
                  |..:           |:|.::|..:.:|:||.:.::|.:|:.|.......||.:.    
Mouse   244 ------EFVV-----------LKKDVDAAYMNKVELEAKVEALMDEINFLRAFFEAELAQL---- 287

  Fly   238 QIEISEIDGRLS--RQYEAKLQQSLQELRDQYEGQMRINREEIELLYDNEIQNLKAAANRAAQGS 300
            |.:|||....||  ......|...:.|::.|||.....:|.|.|..|..:.:.|:.:|.:.....
Mouse   288 QAQISETSVVLSMDNNRSLNLDSIIAEVKAQYEDIANRSRAEAESWYQTKYEELQRSAGQRGDDL 352

  Fly   301 ALATEEVRLMRTKIDGLNAKLQNLEDTNAGLNARIRELENLLDTERQRHNQYIASLEAELQRMRD 365
            .....|:..:...:..|.:::.||:...|.|.|.|.:.|...:...:.....:|.||..||:.:.
Mouse   353 RTTKMEISELNRAMQRLRSEIDNLKKQCATLQASIADAEQRGELALKDAKNKLAELEDALQKAKQ 417

  Fly   366 EMAHQLQEYQGLMDIKVSLDLEIAAYDKLLCGEERRLNIESPG----RPTTDSGIS--SNGSHLT 424
            :||.||:|||.||::|::||:|||.|.|||.|||.||..|..|    ...:.||.:  |.|..|.
Mouse   418 DMARQLREYQELMNVKLALDIEIATYRKLLEGEECRLTGEGVGAVNISVVSSSGGTGYSGGGGLC 482

  Fly   425 ASASSRSGRVTP----------SGRRSATPG--ISGSSAVKR 454
            .|....||....          ||..|:|.|  :||||:..|
Mouse   483 VSGGGYSGGGYSGSGLCYGGGGSGGFSSTSGRSVSGSSSSMR 524

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LamCNP_001260974.1 Filament 45..401 CDD:278467 96/357 (27%)
ATP-synt_B <67..>142 CDD:304375 18/74 (24%)
MreC <178..>224 CDD:302802 10/45 (22%)
LTD 473..574 CDD:279300
Krt90NP_808385.2 Keratin_2_head 16..139 CDD:292825
Filament 142..453 CDD:278467 96/357 (27%)
GluZincin 214..>291 CDD:301352 21/122 (17%)
DUF883 366..>426 CDD:295076 17/59 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.