DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LamC and Krt79

DIOPT Version :9

Sequence 1:NP_001260974.1 Gene:LamC / 36615 FlyBaseID:FBgn0010397 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_666175.1 Gene:Krt79 / 223917 MGIID:2385030 Length:531 Species:Mus musculus


Alignment Length:521 Identity:119/521 - (22%)
Similarity:222/521 - (42%) Gaps:138/521 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 ASTSTPVGGASTSSRVG------ATSPTSP------------------------TRTSRQQEKEE 49
            ||:...:||..:.:.||      ...|..|                        .:..|.||:|:
Mouse    78 ASSGRALGGFGSGAYVGLGASRQTFGPVCPPGGIQEVTVNQSLLTPLNVEIDPEIQRVRTQEREQ 142

  Fly    50 LQHLNDRLACYIDRMRNLENENSRLTQELNLAQDTVNRETS---NLKAVYEKELAAARKLLDETA 111
            ::.||::.|.:||::|.||.:|..|..:..|.|:. ::.|.   :|:..:|..|:..|:.||...
Mouse   143 IKTLNNKFASFIDKVRFLEQQNKVLETKWALLQEQ-SQNTGVARSLEPFFENYLSTLRRQLDTKQ 206

  Fly   112 KEKAKLEIDIKRLWEENDDLKPRLDKKTKEATVAENNARLYENRY-NEVNGKYNQSLADRKKFED 175
            .|:.:|:::::.:.:..:|.|                     |:| :|:|               
Mouse   207 SERGRLDMELRNVQDNLEDFK---------------------NKYEDEIN--------------- 235

  Fly   176 QAKELALENERLRRQLDDLRKQLEAETLARVDLENQNQSLREELAFKDQVHTQELTETR------ 234
              |..|||||.:.     |:|.::|..:.|:||..:..||.:|:.|..|:...||::.:      
Mouse   236 --KRTALENEFVL-----LKKDVDAAYMGRMDLHGKVDSLTQEIDFLQQLFEMELSQVQTNVSDT 293

  Fly   235 -------SRRQIEISEIDGRLSRQYEAKLQQSLQELRDQYEGQMRINREEIELLYDNEIQNLKAA 292
                   :.|.:::..|...:..|||...|:|..|....|:.:.    ||:::.......:|:..
Mouse   294 NVILSMDNNRNLDLDSIIAEVKAQYELIAQKSRAEAESWYQTKY----EELQVTAGKHGDSLRDT 354

  Fly   293 ANRAAQGSALATEEVRLMRTKIDGLNAKLQNLEDTNAGLNARIRELEN-----LLDTERQRHNQY 352
            .|..|:    .|...:.::.::|....:.|.|:       ..|.|.|.     |.|.:::     
Mouse   355 KNEIAE----LTRTTQRLQGEVDAAKKQCQQLQ-------TAIAEAEQNGEMALKDAKKK----- 403

  Fly   353 IASLEAELQRMRDEMAHQLQEYQGLMDIKVSLDLEIAAYDKLLCGEERRLNIESP--------GR 409
            :..|:..|.:.::::|..|:|||.|:.:|::||:|||.|.|||..||.|::.:.|        |.
Mouse   404 LGDLDTALHQAKEDLARMLREYQDLVSVKLALDMEIATYRKLLESEESRMSGDCPSAISISVTGN 468

  Fly   410 PTT---------DSGISSNGSHLTASASSRSGRVTPSGRRSATPG-ISGSSAVKRRRTVIDESED 464
            .|:         .:|:|..|    |..:|:.|..:.....:|..| :||.:::.|:.|.:..|..
Mouse   469 STSVCAGGTAGFGNGLSLGG----AGGASKGGFGSSVSYGAAKGGQVSGGTSILRKTTTVKTSSR 529

  Fly   465 R 465
            |
Mouse   530 R 530

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LamCNP_001260974.1 Filament 45..401 CDD:278467 92/377 (24%)
ATP-synt_B <67..>142 CDD:304375 17/77 (22%)
MreC <178..>224 CDD:302802 16/45 (36%)
LTD 473..574 CDD:279300
Krt79NP_666175.1 Head 1..138 9/59 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..55
Keratin_2_head <62..135 CDD:292825 8/56 (14%)
Filament 138..452 CDD:278467 92/377 (24%)
Coil 1A 139..174 12/34 (35%)
Linker 1 175..194 4/19 (21%)
Coil 1B 195..286 31/133 (23%)
Linker 12 287..310 1/22 (5%)
Coil 2 311..449 39/157 (25%)
Tail 450..531 19/85 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.