DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LamC and Nefl

DIOPT Version :9

Sequence 1:NP_001260974.1 Gene:LamC / 36615 FlyBaseID:FBgn0010397 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_035040.1 Gene:Nefl / 18039 MGIID:97313 Length:543 Species:Mus musculus


Alignment Length:552 Identity:151/552 - (27%)
Similarity:244/552 - (44%) Gaps:98/552 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SARRVTLNTRVSRASTSTPVGGA-----STSSRVGATSP-------------TSPTRTSRQQEKE 48
            |.|......|.:.:|.|.||..:     |.||..|:..|             ::..::.|.|||.
Mouse    28 SVRSGYSTARSAYSSYSAPVSSSLSVRRSYSSSSGSLMPSLENLDLSQVAAISNDLKSIRTQEKA 92

  Fly    49 ELQHLNDRLACYIDRMRNLENENSRLTQELNLAQDTVNRETSNLKAVYEKELAAARKLLDETAKE 113
            :||.||||.|.:|:|:..||.:|..|..|| |.....:.|.|..:|:||:|:...|...::...|
Mouse    93 QLQDLNDRFASFIERVHELEQQNKVLEAEL-LVLRQKHSEPSRFRALYEQEIRDLRLAAEDATNE 156

  Fly   114 KAKLEIDIKRLWEENDDLKPRLDKKTKEATVAENNARLYENRYNEVNGKYNQSLADRKKFEDQAK 178
            |..|:       .|.:.|              |...|..:.||                     :
Mouse   157 KQALQ-------GEREGL--------------EETLRNLQARY---------------------E 179

  Fly   179 ELALENERLRRQLDDLRKQLEAETLARVDLENQNQSLREELAFKDQVHTQELTETRSRRQIEISE 243
            |..|..|....:|.:.||..:...|||.:||.:..||.:|:||..:||.:|:.|.::  ||:.::
Mouse   180 EEVLSREDAEGRLMEARKGADEAALARAELEKRIDSLMDEIAFLKKVHEEEIAELQA--QIQYAQ 242

  Fly   244 IDGRLSRQYEAKLQQSLQELRDQYEGQMRINREEIELLYDNEIQNLKAAANRAAQGSALATEEVR 308
            |...:....:..|..:|:::|.|||.....|.:..|..:.:....|..:|.:.......|.:||.
Mouse   243 ISVEMDVSSKPDLSAALKDIRAQYEKLAAKNMQNAEEWFKSRFTVLTESAAKNTDAVRAAKDEVS 307

  Fly   309 LMRTKIDGLNAKLQNLEDTNAGLNARIRELENLLDTERQRHNQYIASLEAELQRMRDEMAHQLQE 373
            ..|..:.....:::.....|..|..:::|||:..:.:.......|..||.||:..:.|||..|:|
Mouse   308 ESRRLLKAKTLEIEACRGMNEALEKQLQELEDKQNADISAMQDTINKLENELRSTKSEMARYLKE 372

  Fly   374 YQGLMDIKVSLDLEIAAYDKLLCGEERRLNIESPGRPTTDSGISSNGSHLTASASSRSGRVTPSG 438
            ||.|:::|::||:|||||.|||.|||.||:..|.|..|  ||.|        .:|...||...||
Mouse   373 YQDLLNVKMALDIEIAAYRKLLEGEETRLSFTSVGSIT--SGYS--------QSSQVFGRSAYSG 427

  Fly   439 RRSATPGISG-------SSAVKRRRTVIDESEDRTLSEYSVN-AAAKGDLEIIEADVEGRFIKLH 495
            .:|::..:|.       :|.|:..:|.::|:.:.|.:|.:.: ..::|:.|..|.:.|       
Mouse   428 LQSSSYLMSARSFPAYYTSHVQEEQTEVEETIEATKAEEAKDEPPSEGEAEEEEKEKE------- 485

  Fly   496 NKGTEEINLTGWQLTRIAGDEELAFKFSRGSK 527
             :|.||..         |.:||.|...|..:|
Mouse   486 -EGEEEEG---------AEEEEAAKDESEDTK 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LamCNP_001260974.1 Filament 45..401 CDD:278467 104/355 (29%)
ATP-synt_B <67..>142 CDD:304375 19/74 (26%)
MreC <178..>224 CDD:302802 16/45 (36%)
LTD 473..574 CDD:279300 13/56 (23%)
NeflNP_035040.1 Head 2..93 16/64 (25%)
Filament_head 9..88 CDD:309741 12/59 (20%)
Filament 89..400 CDD:306535 104/355 (29%)
Coil 1A 94..125 16/31 (52%)
Linker 1 126..138 2/11 (18%)
Coil 1B 139..234 32/136 (24%)
Linker 12 235..253 3/19 (16%)
Coil 2A 254..272 6/17 (35%)
Linker 2 273..281 2/7 (29%)
Coil 2B 282..397 35/114 (31%)
Epitope, recognized by IF-specific monoclonal antibody 382..392 7/9 (78%)
Tail 398..543 35/137 (26%)
Tail, subdomain A 398..444 16/55 (29%)
Tail, subdomain B (acidic) 445..543 19/80 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 449..543 17/76 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.