DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LamC and Krt17

DIOPT Version :9

Sequence 1:NP_001260974.1 Gene:LamC / 36615 FlyBaseID:FBgn0010397 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_034793.1 Gene:Krt17 / 16667 MGIID:96691 Length:433 Species:Mus musculus


Alignment Length:385 Identity:115/385 - (29%)
Similarity:177/385 - (45%) Gaps:81/385 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 EKEELQHLNDRLACYIDRMRNLENENSRLTQELNLAQDTVNRETSNLKAVYEKELAAARKLLDET 110
            ||..:|:||||||.|:|::|.||..|:.|..:              ::..|:|:.....:     
Mouse    84 EKATMQNLNDRLASYLDKVRALEEANTELEVK--------------IRDWYQKQAPGPAR----- 129

  Fly   111 AKEKAKLEIDIKRLWEENDDLKPRLDKKTKEATVAE-------NNARLYENRYNEVNGKYNQSLA 168
                     |....:...:|||    .|...|||..       :||||..:.:            
Mouse   130 ---------DYSAYYHTIEDLK----NKILVATVDNASILLQIDNARLAADDF------------ 169

  Fly   169 DRKKFE-DQAKELALENE--RLRRQLDDLRKQLEAETLARVDLENQNQSLREELAFKDQVHTQEL 230
             |.||| :||..:::|.:  .|||.||:|       ||||.|||.|.::|:||||:..:.|.:|:
Mouse   170 -RTKFETEQALRMSVEADINGLRRVLDEL-------TLARADLEMQIENLKEELAYLKKNHEEEM 226

  Fly   231 TETRSRRQIEISEIDGRLSRQYEA----KLQQSLQELRDQYEGQMRINREEIELLYDNEIQNLKA 291
            ...|       .::.|.::.:.:|    .|.:.|.|:|||||.....||::.|..:.::.:.|  
Mouse   227 NALR-------GQVGGEINVEMDAAPGVDLSRILSEMRDQYEKMAEKNRKDAEDWFFSKTEEL-- 282

  Fly   292 AANR-AAQGSAL---ATEEVRLMRTKIDGLNAKLQNLEDTNAGLNARIRELENLLDTERQRHNQY 352
              || .|..|.|   ...|:..:|..:..|..:||:.....|.|...:.|.||....:..:....
Mouse   283 --NREVATNSELVQSGKSEISELRRTMQALEIELQSQLSMKASLEGSLAETENRYCVQLSQIQGL 345

  Fly   353 IASLEAELQRMRDEMAHQLQEYQGLMDIKVSLDLEIAAYDKLLCGEERRLNIESPGRPTT 412
            |.|:|.:|.::|.||..|.|||:.|:|:|..|:.|||.|.:||.||:..|....|..|.|
Mouse   346 IGSVEEQLAQLRCEMEQQNQEYKILLDVKTRLEQEIATYRRLLEGEDAHLTQYKPKEPVT 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LamCNP_001260974.1 Filament 45..401 CDD:278467 111/372 (30%)
ATP-synt_B <67..>142 CDD:304375 11/74 (15%)
MreC <178..>224 CDD:302802 20/47 (43%)
LTD 473..574 CDD:279300
Krt17NP_034793.1 Head 1..83
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
Filament 84..394 CDD:333788 111/372 (30%)
Coil 1A 84..120 16/49 (33%)
Linker 1 121..138 2/30 (7%)
Coil 1B 139..230 39/114 (34%)
Linker 12 231..250 2/18 (11%)
Coil 2 251..392 48/144 (33%)
Tail 393..433 4/13 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.