DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LamC and Krt13

DIOPT Version :9

Sequence 1:NP_001260974.1 Gene:LamC / 36615 FlyBaseID:FBgn0010397 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_034792.1 Gene:Krt13 / 16663 MGIID:101925 Length:437 Species:Mus musculus


Alignment Length:405 Identity:125/405 - (30%)
Similarity:192/405 - (47%) Gaps:74/405 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 EKEELQHLNDRLACYIDRMRNLENENSRL---TQELNLAQDTVNRETSNLKAVYEKELAAAR-KL 106
            ||..:|:||||||.|:|::|.||..|:.|   .::.:|.|...:.|..  .:.|.|.:...| |:
Mouse    96 EKITMQNLNDRLASYLDKVRALEAANADLEVKIRDWHLKQSPASPERD--YSAYYKTIEELRIKI 158

  Fly   107 LDETA-KEKAKLEIDIKRLWEENDDLKPRLDKKTKEATVAENNARLYENRYNEVNGKYNQSLADR 170
            |:.|. ..:..||||..||..::..||            .||...|.::...::||         
Mouse   159 LEATTDNNRIILEIDNARLAADDFRLK------------YENELTLRQSVEADING--------- 202

  Fly   171 KKFEDQAKELALENERLRRQLDDLRKQLEAETLARVDLENQNQSLREELAFKDQVHTQELTETRS 235
                            |||.||:|       |||:.|||.|.:||.||||:..:.|.:|:.|.. 
Mouse   203 ----------------LRRVLDEL-------TLAKTDLEMQIESLNEELAYLKKNHEEEMKEFS- 243

  Fly   236 RRQIEISEIDGRLSRQYEA----KLQQSLQELRDQYEGQMRINREEIELLYDNEIQNLKAAANRA 296
                  :::.|:::.:.:|    .|.:.|.|:|:|||.....||.:.|..:..:...|....:..
Mouse   244 ------NQVVGQVNVEMDATPGIDLTRVLAEMREQYEALAEKNRRDAEEWFQTKSAELNKEVSSN 302

  Fly   297 AQGSALATEEVRLMRTKIDGLNAKLQNLEDTNAGLNARIRELENLLDTERQRHNQYIASLEAELQ 361
            |:....:..|:..:|..:.||..:||:.....|||.:.:.|.|.....:.|:....|:|:||:|.
Mouse   303 AEMIQTSKTEITELRRTLQGLEIELQSQLSMKAGLESTLAETECRYALQLQQIQGLISSIEAQLS 367

  Fly   362 RMRDEMAHQLQEYQGLMDIKVSLDLEIAAYDKLLCGEERRL-NIESPGRPTTDSGISSNGSHLTA 425
            .:|.||..|.|||:.|:|||..|:.|||.|..||.|::.:: ...|.|..||    :|||     
Mouse   368 ELRSEMECQNQEYKMLLDIKTRLEQEIATYRSLLEGQDAKMTGFNSGGNNTT----TSNG----- 423

  Fly   426 SASSRSGRVTPSGRR 440
            |.||.|||  |..|:
Mouse   424 SPSSNSGR--PDFRK 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LamCNP_001260974.1 Filament 45..401 CDD:278467 110/363 (30%)
ATP-synt_B <67..>142 CDD:304375 21/79 (27%)
MreC <178..>224 CDD:302802 19/45 (42%)
LTD 473..574 CDD:279300
Krt13NP_034792.1 Head 1..95
Filament 95..407 CDD:278467 110/363 (30%)
Coil 1A 96..131 16/34 (47%)
Linker 1 132..150 4/19 (21%)
Coil 1B 151..242 38/134 (28%)
Linker 12 243..265 3/28 (11%)
Coil 2 266..404 46/137 (34%)
Tail 405..437 15/43 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 408..437 15/40 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.