DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LamC and LOC100653049

DIOPT Version :9

Sequence 1:NP_001260974.1 Gene:LamC / 36615 FlyBaseID:FBgn0010397 Length:640 Species:Drosophila melanogaster
Sequence 2:XP_003403930.1 Gene:LOC100653049 / 100653049 -ID:- Length:436 Species:Homo sapiens


Alignment Length:398 Identity:115/398 - (28%)
Similarity:185/398 - (46%) Gaps:97/398 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 EKEELQHLNDRLACYIDRMRNLENENS---RLTQELNLAQDTV--NRETSNLKAVYEKELAAARK 105
            |||.:|.||||||.|::::|.||.:|:   :|.||.:..|:.:  ....|..|.:.|.:    :|
Human    98 EKETMQFLNDRLASYLEKVRQLERDNAELEKLIQERSQQQEPLLCPSYQSYFKTIEELQ----QK 158

  Fly   106 LLDETAKEKAKLEIDIKRLWEENDDLKPRLDKKTKEATVAENNARLYENRYNEVNGKYNQSLADR 170
            :|...| |.|:|.::|                         :||:|..:.:             |
Human   159 ILCAKA-ENARLVVNI-------------------------DNAKLASDDF-------------R 184

  Fly   171 KKFE-DQAKELALENE--RLRRQLDDLRKQLEAETLARVDLENQNQSLREELAFKDQVHTQELTE 232
            .|:: :|:..|.:|::  .:||.||:|       ||.:.|||:|.:||||||....:.|.:|:..
Human   185 SKYQTEQSLRLLVESDINSIRRILDEL-------TLCKSDLESQVESLREELICLKKNHEEEVNT 242

  Fly   233 TRSRRQIEISEIDGRLSRQYE----AKLQQSLQELRDQYEGQMRINREEIELLYDNEIQNL-KAA 292
            .|       |::..||:.:.:    ..|.|.|.|.|.|||..:..||.|:|..:..:.:.| |..
Human   243 LR-------SQLGDRLNVEVDTAPTVDLNQVLNETRSQYEALVETNRREVEQWFATQTEELNKQV 300

  Fly   293 ANRAAQGSALATEEVRLMRTKIDGLNAKLQ---NLEDTNAGLNARIRELENLLDTERQRH----- 349
            .:.:.|..:...|.:.|.|| ::.|..:||   ||.|:          |||.| ||.:.|     
Human   301 VSSSEQLQSCQAEIIELRRT-VNALEIELQAQHNLRDS----------LENTL-TESEAHYSSQL 353

  Fly   350 ---NQYIASLEAELQRMRDEMAHQLQEYQGLMDIKVSLDLEIAAYDKLLCGEERRLNIESPGRPT 411
               ...|.::|::|..:|.::..|.||||.|:|::..|:.||..|..||..|:.:|    |..|.
Human   354 SQVQSLITNVESQLAEIRCDLERQNQEYQVLLDVRARLECEINTYRSLLESEDCKL----PCNPC 414

  Fly   412 TDSGISSN 419
            ..:..|.|
Human   415 ATTNASGN 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LamCNP_001260974.1 Filament 45..401 CDD:278467 110/378 (29%)
ATP-synt_B <67..>142 CDD:304375 17/79 (22%)
MreC <178..>224 CDD:302802 19/47 (40%)
LTD 473..574 CDD:279300
LOC100653049XP_003403930.1 Filament 97..408 CDD:306535 110/378 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.