DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LamC and krt78.1

DIOPT Version :9

Sequence 1:NP_001260974.1 Gene:LamC / 36615 FlyBaseID:FBgn0010397 Length:640 Species:Drosophila melanogaster
Sequence 2:XP_002935786.2 Gene:krt78.1 / 100491159 XenbaseID:XB-GENE-6035591 Length:493 Species:Xenopus tropicalis


Alignment Length:431 Identity:105/431 - (24%)
Similarity:208/431 - (48%) Gaps:67/431 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 RQQEKEELQHLNDRLACYIDRMRNLENENSRLTQELNL--AQDTVNRETSNLKAVYEKELAAARK 105
            |::|:|:::.||::.|.:||::|.||.:|..|..:.:|  .|......:|.:::::...:.:.|.
 Frog   119 RKEEREKIKLLNNKFASFIDKVRFLEQQNKVLETKWSLLQKQQVSKSRSSEIESIFNTLITSLRS 183

  Fly   106 LLDETAKEKAKLEIDIKRLWEENDDLKPRLDKKTKEATVAENNARLYENRYNEVNGKYNQSLADR 170
            .||...|:|..|..:::.:.:..::.|.:.:.:.|:.|..||:                      
 Frog   184 QLDSLVKDKGLLGGELQVMKDHAENFKNKFELEFKKRTADEND---------------------- 226

  Fly   171 KKFEDQAKELALENERLRRQLDDLRKQLEAETLARVDLENQNQSLREELAFKDQVHTQELTETRS 235
                                ...|:|.::|..|.:|.||.:.::|.:||||...::.:||...:.
 Frog   227 --------------------FVSLKKDVDATYLIQVQLETKQKALDDELAFLRNLYKEELDGIKQ 271

  Fly   236 R---RQIEISEIDGRLSRQYEAKLQQSLQELRDQYEGQMRINREEIELLYDNEIQNLKAAANRAA 297
            :   ..:.:|..:.|:     ..|...:.:::.|||...|.::||.|..|.::.|.|:.||.:..
 Frog   272 QTAGTSVVLSMDNSRM-----LDLGDIIADVKAQYEDTTRRSKEEAEAAYQSKYQQLQLAAGQQG 331

  Fly   298 QGSALATEEVRLMRTKIDGLNAKLQNLEDTNAGLNARIRELENLLDTERQRHNQYIASLEAELQR 362
            :....:.:|:..:...:..|..::::::...|.|...|::.|...|...:...:.:.:||..||:
 Frog   332 EDLKSSKKEISEVNRSVQKLRNEIESVKKQIASLQVSIQDSERRGDIALRDAQEKLVNLERALQK 396

  Fly   363 MRDEMAHQLQEYQGLMDIKVSLDLEIAAYDKLLCGEERRLNIESPGRPTTDSGIS-SNGSHLTAS 426
            .:.|||.||:|||.|:::|::||:|||.|.|||.|||.|:.    |:.:....:| .:|:..:..
 Frog   397 AKQEMAQQLREYQTLLNVKLALDVEIATYRKLLEGEESRIT----GQVSDAVTVSFVSGAKSSFD 457

  Fly   427 ASSRSGRVTPSGRRSATPGISGSSAVKRRRTVIDESEDRTL 467
            |:.||..:....:|      .|||.||    :|.::|..:|
 Frog   458 ATKRSAGIDTGVKR------RGSSGVK----IISKTESSSL 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LamCNP_001260974.1 Filament 45..401 CDD:278467 88/360 (24%)
ATP-synt_B <67..>142 CDD:304375 15/76 (20%)
MreC <178..>224 CDD:302802 12/45 (27%)
LTD 473..574 CDD:279300
krt78.1XP_002935786.2 Keratin_2_head <94..118 CDD:374433
Filament 121..435 CDD:365827 88/360 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D204815at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.