DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LamC and krt98

DIOPT Version :9

Sequence 1:NP_001260974.1 Gene:LamC / 36615 FlyBaseID:FBgn0010397 Length:640 Species:Drosophila melanogaster
Sequence 2:XP_005155788.1 Gene:krt98 / 100124615 ZFINID:ZDB-GENE-070822-8 Length:391 Species:Danio rerio


Alignment Length:414 Identity:108/414 - (26%)
Similarity:194/414 - (46%) Gaps:90/414 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SRASTSTPVGGA-STSSRVGATSPTSPTRTSRQ------------QEKEELQHLNDRLACYIDRM 64
            |.:.|.:..||| ...:|:  :||.....:|.:            .:|..:|:||.|||.|::::
Zfish     5 SNSKTLSVYGGAGGRGTRI--SSPAGFLNSSPRGFNLVDGLDLSADKKATMQNLNTRLASYLEKV 67

  Fly    65 RNLENENSRLTQELN---LAQDTVNRETSNLKAVYEKELAAARKLLDETAKEKAKLEIDIKRLWE 126
            |:||..|:.|.|:::   .:.|.|..:.:|    ::..:...|...:..:::.|||.:::.....
Zfish    68 RSLEKANTELEQKISDWYDSHDDVTFDHTN----FQDTIQDLRNEFNTRSQDNAKLILEVDNAKL 128

  Fly   127 ENDDLKPRLDKKTKEATVAENNARLYENRYNEVNGKYNQSLADRKKFEDQAKELALENERLRRQL 191
            ..||.|                 |.|||                        |||:..| :....
Zfish   129 AADDFK-----------------RKYEN------------------------ELAMRRE-IEADT 151

  Fly   192 DDLRKQLEAETLARVDLENQNQSLREELAFKDQVHTQELTET-RSRRQIEISEIDGRLSRQYEAK 255
            .:|||.|:..:|:|.|||.|.::|:||.....:.|.:.:|.| .:..|:.:| :|...|..    
Zfish   152 GNLRKILDEFSLSRSDLELQIEALKEEFIVLKKNHKENITLTIETGGQVNVS-VDAAPSMD---- 211

  Fly   256 LQQSLQELRDQYEGQMRINREEIELLYDNEIQNLKAAANRAAQGSALATEEVRLMRTKIDGLNAK 320
            |.|::.|:|..||...:.||||:|..|::::..::       |..:...||::..||::..|.:.
Zfish   212 LNQAIDEIRQHYETVTQKNREELESWYESKMAPMQ-------QEVSNHNEELQDSRTELKDLTST 269

  Fly   321 LQNLE---DTNAGLNARI-RELENLLDTERQRHNQY------IASLEAELQRMRDEMAHQLQEYQ 375
            ||.|:   .|:..:.:.: .:||   |||.:..||.      :::||.:|.:....:|:..:||:
Zfish   270 LQRLQIELQTHQSMKSNLDGQLE---DTEARYGNQLAGLQTTVSNLEDQLSQFHANIANNKEEYE 331

  Fly   376 GLMDIKVSLDLEIAAYDKLLCGEE 399
            .|:|:|..|:.|||.|.:||.||:
Zfish   332 TLLDVKTRLEREIAEYRRLLDGEK 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LamCNP_001260974.1 Filament 45..401 CDD:278467 99/369 (27%)
ATP-synt_B <67..>142 CDD:304375 15/77 (19%)
MreC <178..>224 CDD:302802 17/45 (38%)
LTD 473..574 CDD:279300
krt98XP_005155788.1 Filament 50..356 CDD:278467 99/367 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.