DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LamC and krt7

DIOPT Version :9

Sequence 1:NP_001260974.1 Gene:LamC / 36615 FlyBaseID:FBgn0010397 Length:640 Species:Drosophila melanogaster
Sequence 2:XP_002935788.2 Gene:krt7 / 100101751 XenbaseID:XB-GENE-876869 Length:523 Species:Xenopus tropicalis


Alignment Length:489 Identity:136/489 - (27%)
Similarity:230/489 - (47%) Gaps:98/489 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 GGASTSSRVGATSP------------------TSPT-RTSRQQEKEELQHLNDRLACYIDRMRNL 67
            |||.....|..:.|                  ..|| :..||:|:|:::.||::.|.:||::|.|
 Frog    92 GGAGFGGGVAYSGPGIQEVTINQSLLAPLNLEIDPTIQHVRQEEREQIKTLNNKFASFIDKVRFL 156

  Fly    68 ENENSRLTQELNLAQDTVNRETSNLKAVYEKELAAARKLLDETAKEKAKLEIDIKRLWEENDDLK 132
            |.:|..|..:..|.|:..:.:.||:..:::..:|..|:.||....:|.|||.:::.:.:..:|.|
 Frog   157 EQQNKVLETKWELLQNQKSAKASNVGPLFDAYIANLRRQLDGLTGDKGKLEGELRNMQDLVEDFK 221

  Fly   133 PRLDKKTKEATVAENNARLYENRY-NEVNGKYNQSLADRKKFEDQAKELALENERLRRQLDDLRK 196
                                 |:| :|:|                 |..:.|||.:     .|:|
 Frog   222 ---------------------NKYEDEIN-----------------KRTSAENEFV-----VLKK 243

  Fly   197 QLEAETLARVDLENQNQSLREELAFKDQVHTQELTETRSRRQIEISEIDGRLSRQYEAKLQQS-- 259
            .::|..:.:|:||.:.::|.:|:.|...::..||.|.    |.:||:....||......|...  
 Frog   244 DVDAAYMNKVELEAKMEALTDEINFLRALYEAELREL----QEQISDTSVVLSMDNNRALDMDSI 304

  Fly   260 LQELRDQYEGQMRINREEIELLYDNEIQNLKAAANRAAQGSALATEEVRLMRTKIDGLN------ 318
            :.|::.|||.....:|...|.:|.|:.|.|:|.|.|..       :::|..:|:|..||      
 Frog   305 IAEVKAQYEDIANKSRANAEAVYQNKFQELQATAGRHG-------DDLRTTKTEISELNRAMQRL 362

  Fly   319 -AKLQNLEDTNAGLNARIRELENLLDTERQRHNQYIASLEAELQRMRDEMAHQLQEYQGLMDIKV 382
             |::::::...|.|.|:|.|.|...:...:.....:|.|||.||:.:.:||.||:|||.||::|:
 Frog   363 QAEIESVKAQRAKLEAQIAEAEERGELALKDARTKLAELEAALQKAKQDMARQLREYQELMNVKL 427

  Fly   383 SLDLEIAAYDKLLCGEERRLNIESPGRPTTDSGISSNGSHLTASAS----------SRSGRVTPS 437
            :||:|||.|.|||.|||.|:: |.|| |.:.|.::|..|.:..|:|          ...|..:..
 Frog   428 ALDIEIATYRKLLEGEETRIS-EGPG-PVSVSVVNSTSSSMGGSSSGYGAGYGSGFGAGGSFSSG 490

  Fly   438 GRRSATP--GISGSSAVKRRRTVIDESEDRTLSE 469
            |..|::.  |..|||.|| ..:|...|..|:..:
 Frog   491 GFGSSSTKFGSGGSSGVK-SYSVTTSSSSRSFRQ 523

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LamCNP_001260974.1 Filament 45..401 CDD:278467 105/365 (29%)
ATP-synt_B <67..>142 CDD:304375 18/74 (24%)
MreC <178..>224 CDD:302802 13/45 (29%)
LTD 473..574 CDD:279300
krt7XP_002935788.2 Keratin_2_head <106..131 CDD:374433 2/24 (8%)
Filament 134..446 CDD:365827 105/365 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.