DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ttv and AT1G68470

DIOPT Version :9

Sequence 1:NP_001356963.1 Gene:ttv / 36614 FlyBaseID:FBgn0265974 Length:772 Species:Drosophila melanogaster
Sequence 2:NP_177014.1 Gene:AT1G68470 / 843176 AraportID:AT1G68470 Length:455 Species:Arabidopsis thaliana


Alignment Length:386 Identity:79/386 - (20%)
Similarity:129/386 - (33%) Gaps:104/386 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 FDFT---------RCYDRFLVYIYP-PEPLN---------------------SLGAAPP-----T 123
            |.||         .|...|.||:|. |:..|                     :.|...|     |
plant    53 FPFTIEFTASIPRTCDHNFTVYVYDLPKEFNIGLLQNCRHLNIYTNMCPHVANNGLGQPLHRGRT 117

  Fly   124 S--ANYQKILTAIQESRY-----YTSDPTAACLFVL----GI---------DTLDRDSLSEDYVR 168
            |  :.:|.|...|..:|.     .|.:|..|.:|.:    |:         :...||.|:...|.
plant   118 SWFSTHQFIAEMIFHARVENHPCRTYEPDTADIFYVPFYGGLYASSVFREQNLTKRDELAVRLVN 182

  Fly   169 NVPSRLARLPYW--NNGRNHIIFNLYSGTWPDYAENSLGFDAGEAILAK----ASMGVLQLR--- 224
            .:..:    .:|  :|||:|.: .:....| |:..:| ..|.|..:|.:    .:|.||.:.   
plant   183 YISGQ----RWWKRSNGRDHFL-AIGRTAW-DFMRSS-DTDFGANMLMQMPRVMNMSVLTVERQP 240

  Fly   225 ----HGFDVSIP-LFHKQFPLRAGATGTVQSNNFPANKKYLLAFKGKRYVHGIGSETRNSLFHLH 284
                :.|.:..| .||   |..:....|.|.......:..|.:|.|........:..|:.|....
plant   241 WNGDNHFGIPYPSYFH---PYTSAEMVTWQDKMKNVERPNLFSFVGGPRKGLEKAAIRDELIKQC 302

  Fly   285 NGRDMVLVTTCRHGKSWRELQDNRCDEDNREYDRYDYETLLQNSTFCLVPRGRRLGSFRFLEALQ 349
            .......:..|.:|.|       ||      ::......::..|.|||...|.........:|:.
plant   303 AESSHCELLKCENGGS-------RC------HNPMTVLGVMARSRFCLQAPGDSFTRRSTFDAML 354

  Fly   350 AGCIPVLLS-------NAWVLPFESKIDWKQAAIWADERLLLQVPDIVRSIPAERIFALRQ 403
            ||||||..|       ..|.||    .|.:..:::.||:....:...:..|....:..:|:
plant   355 AGCIPVFFSPHTMYTQYMWYLP----DDKRSYSVFMDEKNNTHIEQELLRISENEVVQMRE 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ttvNP_001356963.1 Exostosin 102..393 CDD:335188 73/358 (20%)
Glyco_transf_64 477..737 CDD:337333
AT1G68470NP_177014.1 Exostosin 69..398 CDD:397245 73/355 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D789556at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.