DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ttv and AT1G67410

DIOPT Version :9

Sequence 1:NP_001356963.1 Gene:ttv / 36614 FlyBaseID:FBgn0265974 Length:772 Species:Drosophila melanogaster
Sequence 2:NP_176908.2 Gene:AT1G67410 / 843061 AraportID:AT1G67410 Length:430 Species:Arabidopsis thaliana


Alignment Length:289 Identity:68/289 - (23%)
Similarity:107/289 - (37%) Gaps:80/289 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 YWN--NGRNHIIFNLYSGTWPDYAENSLGF---DAGEAILAKASMGVL---QLRHGFDVSIPLFH 235
            |||  .|::|:|        |....|:..|   ....:||.....|..   ..|...||..|..|
plant   170 YWNRSGGKDHVI--------PMTHPNAFRFLRQQVNASILIVVDFGRYSKDMARLSKDVVSPYVH 226

  Fly   236 KQFPLRAGATGTVQSNN----------FPANKKYLLAFKGKRYVHGIGSETRNSLFHLHNGRDMV 290
                       .|:|.|          |.| :..||.|:|.. |.....:.|..|..|..|...|
plant   227 -----------VVESLNEEGDDGMGDPFEA-RTTLLYFRGNT-VRKDEGKIRLRLEKLLAGNSDV 278

  Fly   291 LVTTCRHGKSWRELQDNRCDEDNREYDRYDYETLLQNSTFCLVPRGRRLGSFRFLEALQAGCIPV 355
                 ...||....|:.:...:.           :::|.|||.|.|....|.|..:|:.:.||||
plant   279 -----HFEKSVATTQNIKVSTEG-----------MRSSKFCLHPAGDTPSSCRLFDAIVSHCIPV 327

  Fly   356 LLSNAWVLPFESKIDWKQAAIWADERLLLQ---VPDIVRSIPAERIFALRQQTQVLWERYFGSIE 417
            ::|:...||||.:||:.:.:::...:..|:   :.:.:|..|.|:...       :|:|.     
plant   328 IISDKIELPFEDEIDYSEFSLFFSIKESLEPGYILNNLRQFPKEKWLE-------MWKRL----- 380

  Fly   418 KIVFTTFEIIRERLPDYPVRS----SLVW 442
            |.|...||.      .||.:.    :::|
plant   381 KNVSHHFEF------QYPPKREDAVNMLW 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ttvNP_001356963.1 Exostosin 102..393 CDD:335188 57/234 (24%)
Glyco_transf_64 477..737 CDD:337333
AT1G67410NP_176908.2 Exostosin 49..365 CDD:397245 56/231 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D789556at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.