DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ttv and RHS8

DIOPT Version :9

Sequence 1:NP_001356963.1 Gene:ttv / 36614 FlyBaseID:FBgn0265974 Length:772 Species:Drosophila melanogaster
Sequence 2:NP_176534.2 Gene:RHS8 / 842651 AraportID:AT1G63450 Length:664 Species:Arabidopsis thaliana


Alignment Length:351 Identity:74/351 - (21%)
Similarity:131/351 - (37%) Gaps:104/351 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 TAACLFVL----GIDTLD----------RDSLSEDYVRNVPSRLARLPYW--NNGRNHIIFNLYS 193
            |.|.||.:    |:|.|.          :|.|..:.|:.:.|:.:    |  |:|::| :|.|..
plant   357 TQAKLFYVPFYGGMDVLRWHFKNVSSDVKDVLPIEIVKWLGSKKS----WRKNSGKDH-VFVLGK 416

  Fly   194 GTWPDYAENSLGFDAGEAILAKASM----GVLQLRHGF---DVSIP---LFHKQFPLRAGATGTV 248
            .:| |:.... .:..|.::|....|    .:|..|:.:   |::||   .||   |.........
plant   417 ISW-DFRRVD-KYSWGSSLLEMQEMKNPTKLLIERNPWEVNDIAIPHPTYFH---PKTDTDIAIW 476

  Fly   249 QSNNFPANKKYLLAFKGKRYVHGIGSETRNSLFHLHNGRDMVLVTTCRHGKS---WRELQDNRCD 310
            |:......::.|::|.|... .|.....|:           :|:..||...:   :....|..||
plant   477 QNKILGKPRRSLISFAGAAR-PGNPESIRS-----------ILIDQCRSSPNQCRFLNCTDGGCD 529

  Fly   311 EDNREYDRYDYETLLQNSTFCLVPRGRRLGSFRFLEALQAGCIPVLL-------SNAWVLPFESK 368
            :.....:      |.::|.|||.|.|.........::|..|||||:.       ...|.||    
plant   530 KSESVIE------LFRDSEFCLQPPGDSPTRKSIFDSLILGCIPVIFDPYSAYYQYTWHLP---- 584

  Fly   369 IDWKQAAIWADERLLLQVPDIVRSIPAERIFALRQQTQVLWERYFGSIEKIVFTTFEIIRERLPD 433
            .|.::.:::.::          ..:..:|:               ..|||::..|   :|||   
plant   585 EDHRRYSVYINK----------EDVKLKRV---------------NVIEKLMSKT---LRER--- 618

  Fly   434 YPVRSSLVWNSSPGALLTLPTFADSS 459
            ..:||.:|....||.:     :.||:
plant   619 EDMRSYIVHELLPGLV-----YGDSN 639

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ttvNP_001356963.1 Exostosin 102..393 CDD:335188 59/283 (21%)
Glyco_transf_64 477..737 CDD:337333
RHS8NP_176534.2 Exostosin 278..610 CDD:281069 62/309 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D789556at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.