DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ttv and GUT2

DIOPT Version :9

Sequence 1:NP_001356963.1 Gene:ttv / 36614 FlyBaseID:FBgn0265974 Length:772 Species:Drosophila melanogaster
Sequence 2:NP_174064.1 Gene:GUT2 / 839635 AraportID:AT1G27440 Length:412 Species:Arabidopsis thaliana


Alignment Length:343 Identity:74/343 - (21%)
Similarity:127/343 - (37%) Gaps:94/343 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   178 PYWN--NGRNHIIFNLYS-GTWPDYAENSLGFDAGEAILAKASMGVLQ---------------LR 224
            ||||  .|.:|.....:. |....|.|        |..:.:..:.:||               |.
plant   136 PYWNRTEGADHFFVVPHDFGACFHYQE--------EKAIERGILPLLQRATLVQTFGQRNHVCLD 192

  Fly   225 HGFDVSIPLFHKQFPLRAGATGTVQSNNFPAN--KKYLLAFKGKRYVHGIGSETRNSLFHLHNGR 287
            .| .::||.|        .....:|::..|.:  :...:.|:|..|  .:.::.... ::....|
plant   193 EG-SITIPPF--------APPQKMQAHFIPPDIPRSIFVYFRGLFY--DVNNDPEGG-YYARGAR 245

  Fly   288 DMVLVTTCRHGKSWRELQDNRCDEDNREYDRYDYETLLQNSTFCLVPRGRRLGSFRFLEALQAGC 352
            ..|          |...::|...:.:.::....||. :|.:.|||.|.|....|.|.:||:..||
plant   246 AAV----------WENFKNNPLFDISTDHPTTYYED-MQRAIFCLCPLGWAPWSPRLVEAVVFGC 299

  Fly   353 IPVLLSNAWVLPFESKIDWKQAAIWADERLLLQVPDIVRSIPAERIFALRQQTQVLWERYFGSIE 417
            |||::::..||||...|.|::..::..|:.:.::..|:.|||.|.|  ||:|             
plant   300 IPVIIADDIVLPFADAIPWEEIGVFVAEKDVPELDTILTSIPTEVI--LRKQ------------- 349

  Fly   418 KIVFTTFEIIRERLPDYPVRSSLVWNSSPGALLTLPTFADSSRYMPFLLNSMGAEPRHNYTAVIY 482
                                 .|:.|.|....:..|..|........:||.:..:..|:.:  ||
plant   350 ---------------------RLLANPSMKRAMLFPQPAQPGDAFHQILNGLARKLPHDKS--IY 391

  Fly   483 VQIGA-----ALGPNAAL 495
            ::.|.     ..||.|.|
plant   392 LKTGEKALNWTAGPVADL 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ttvNP_001356963.1 Exostosin 102..393 CDD:335188 51/234 (22%)
Glyco_transf_64 477..737 CDD:337333 7/24 (29%)
GUT2NP_174064.1 Exostosin 45..340 CDD:397245 51/234 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3137
eggNOG 1 0.900 - - E1_KOG1021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 44 1.000 Inparanoid score I2684
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D789556at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.870

Return to query results.
Submit another query.