DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ttv and AT1G21480

DIOPT Version :9

Sequence 1:NP_001356963.1 Gene:ttv / 36614 FlyBaseID:FBgn0265974 Length:772 Species:Drosophila melanogaster
Sequence 2:NP_564141.1 Gene:AT1G21480 / 838746 AraportID:AT1G21480 Length:462 Species:Arabidopsis thaliana


Alignment Length:339 Identity:76/339 - (22%)
Similarity:133/339 - (39%) Gaps:95/339 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 VYIYPPEPLNSL--------GAAPPTS------ANYQKILTAIQESRYYTSDPTAACLF------ 150
            :|:|....::.|        |:...|:      .:..||...:.||::.|.....|.||      
plant    91 IYVYDENEIDGLKELLYGRDGSVKTTACLKGQWGSQVKIHKLLLESKFRTIKKDEADLFFVPAYV 155

  Fly   151 --VLGIDTLDRDSLSEDYVRNVPSRLARLPYW--NNGRNHI-IFNLYSG-----TWPDYAENSL- 204
              |..:..|:...:::.||:    .|:::||:  :.||:|| :|...:|     :|..:...|: 
plant   156 KCVRMLGGLNDKEINQTYVK----VLSQMPYFRRSGGRDHIFVFPSGAGAHLFRSWSTFINRSII 216

  Fly   205 --------------GFDAGEAILAKASMGVLQLRHGFDVSIPLFHKQFPLRAGATGTVQSNNFPA 255
                          .|::.:.|:...::.....::|.....||     ||              :
plant   217 LTPEADRTDKKDTTAFNSWKDIIIPGNVDDAMTKNGQPDVQPL-----PL--------------S 262

  Fly   256 NKKYLLAFKGKRYVHGIGSETRNSLFHLHNGRDMVLVTTCRHGKSWRELQDN-RCDE----DNRE 315
            .:|||..:.|:..    |...|..|..|.                 ::..|. .|.:    ...:
plant   263 KRKYLANYLGRAQ----GKAGRLKLIDLS-----------------KQFPDKLECPDLKFSGTEK 306

  Fly   316 YDRYDYETLLQNSTFCLVPRGRRLGSFRFLEALQAGCIPVLLSNAWVLPFESKIDWKQAAI-WAD 379
            :.|..|...|:|:.|||.|||....:.||.|:....|:|||||:...|||::.||:.|.:| |..
plant   307 FGRTTYFEHLRNAKFCLAPRGESSWTLRFYESFFVECVPVLLSDHAELPFQNVIDYAQVSIKWPS 371

  Fly   380 ERLLLQVPDIVRSI 393
            .|:..:..|.:.||
plant   372 TRIGSEFLDYLASI 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ttvNP_001356963.1 Exostosin 102..393 CDD:335188 74/337 (22%)
Glyco_transf_64 477..737 CDD:337333
AT1G21480NP_564141.1 Exostosin 89..374 CDD:397245 72/326 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D789556at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.