DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ttv and GUT1

DIOPT Version :9

Sequence 1:NP_001356963.1 Gene:ttv / 36614 FlyBaseID:FBgn0265974 Length:772 Species:Drosophila melanogaster
Sequence 2:NP_568941.1 Gene:GUT1 / 836306 AraportID:AT5G61840 Length:415 Species:Arabidopsis thaliana


Alignment Length:421 Identity:97/421 - (23%)
Similarity:163/421 - (38%) Gaps:99/421 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ILVFVSCAFLAYAYFGGYRLKVSPLRPRRAQHESAKDGGV---QPHEQLPSFLGAHDMQELQLLQ 69
            :|:|:.|.  .::....:||.    |.:..:..|...|.|   .|..:|..|     :.||    
plant     7 VLIFLLCN--TFSSISAFRLS----RSQPTERISGSAGDVLEDDPVGRLKVF-----VYEL---- 56

  Fly    70 SNQSKSLDSSKHLVTRKPDCRMETCFDFTRCYDRFLVYIYPPEPLNSLGAAPPTSANYQKILTAI 134
              .||   .:|.::.:.|.| :...|.......|||:    ..|:.:|.   |..|::..:..  
plant    57 --PSK---YNKKILQKDPRC-LNHMFAAEIYMQRFLL----SSPVRTLN---PEEADWFYVPV-- 106

  Fly   135 QESRYYTSDPTAACLFVLGIDTLDRDSLSEDYVRNVPSRLA-RLPYWN--NGRNHIIFNLYS-GT 195
                |.|.|.|.        :.|.....|...:|:....:| ..||||  .|.:|.....:. |.
plant   107 ----YTTCDLTP--------NGLPLPFKSPRMMRSAIQLIASNWPYWNRTEGADHFFVVPHDFGA 159

  Fly   196 WPDYAENSLGFDAGEAILAKASMGVLQ---------------LRHGFDVSIPLFHKQFPLRAGAT 245
            ...|.|        |..:.:..:.:||               |:.| .:::|.:        ...
plant   160 CFHYQE--------EKAIGRGILPLLQRATLVQTFGQRNHVCLKEG-SITVPPY--------APP 207

  Fly   246 GTVQSNNFPAN--KKYLLAFKGKRYVHGIGSETRNSLFHLHNGRDMVLVTTCRHGKSWRELQDNR 308
            ..:||:..|..  :...:.|:|..|  .:|::.... ::....|..|          |...:||.
plant   208 QKMQSHLIPEKTPRSIFVYFRGLFY--DVGNDPEGG-YYARGARAAV----------WENFKDNP 259

  Fly   309 CDEDNREYDRYDYETLLQNSTFCLVPRGRRLGSFRFLEALQAGCIPVLLSNAWVLPFESKIDWKQ 373
            ..:.:.|:....||. :|.:.|||.|.|....|.|.:||:..|||||::::..||||...|.|:.
plant   260 LFDISTEHPTTYYED-MQRAIFCLCPLGWAPWSPRLVEAVIFGCIPVIIADDIVLPFADAIPWED 323

  Fly   374 AAIWADERLLLQVPDIVRSIPAERIFALRQQ 404
            ..::.||:.:..:..|:.|||.|.|  ||:|
plant   324 IGVFVDEKDVPYLDTILTSIPPEVI--LRKQ 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ttvNP_001356963.1 Exostosin 102..393 CDD:335188 69/311 (22%)
Glyco_transf_64 477..737 CDD:337333
GUT1NP_568941.1 Exostosin 48..343 CDD:397245 79/361 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3137
eggNOG 1 0.900 - - E1_KOG1021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 44 1.000 Inparanoid score I2684
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D789556at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.