DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ttv and ARAD2

DIOPT Version :9

Sequence 1:NP_001356963.1 Gene:ttv / 36614 FlyBaseID:FBgn0265974 Length:772 Species:Drosophila melanogaster
Sequence 2:NP_199306.1 Gene:ARAD2 / 834523 AraportID:AT5G44930 Length:443 Species:Arabidopsis thaliana


Alignment Length:326 Identity:78/326 - (23%)
Similarity:130/326 - (39%) Gaps:83/326 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 DPTAACLFVLGIDTLDRDSLS--------------EDYVRNVPSRLARLPYW--NNGRNHIIF-- 189
            ||..|.||.:...:    |||              |:...::.|.|....:|  ||||:|:|.  
plant   129 DPAEADLFYVSAFS----SLSLIVDSGRPGFGYSDEEMQESLVSWLESQEWWRRNNGRDHVIVAG 189

  Fly   190 --NLYSGTWPDYAENSL----GFD---AGEAILAKASMGVLQLRHGFDVSIPLFHKQFPLRAGAT 245
              |...... |..:|::    .||   |.:..|.|            ||.||..|: .....|..
plant   190 DPNALKRVM-DRVKNAVLLVTDFDRLRADQGSLVK------------DVIIPYSHR-IDAYEGEL 240

  Fly   246 GTVQSNNFPANKKYLLAFKGKRYVHGIGSETRNSLFH-LHNGRDMVLVTTCRHGKSWRELQDNRC 309
            |..|..|       ||.|.|.|| ...|.:.|:.||. |....|:|:....:..::.|.::..  
plant   241 GVKQRTN-------LLFFMGNRY-RKDGGKVRDLLFKLLEKEEDVVIKRGTQSRENMRAVKQG-- 295

  Fly   310 DEDNREYDRYDYETLLQNSTFCLVPRGRRLGSFRFLEALQAGCIPVLLSNAWVLPFESKIDWKQA 374
                           :..|.|||...|....:.|..:|:.:.|:||::|:...||||..||:::.
plant   296 ---------------MHTSKFCLHLAGDTSSACRLFDAIASLCVPVIVSDGIELPFEDVIDYRKF 345

  Fly   375 AIWADERLLLQVPDIVRSIPAERIFALRQQTQVLWE--RYF------GSIEKIVFTTFEIIRERL 431
            :|:......|:...:|:.:...:...:.:..:|:.|  |||      ||:.:|    :..:.:::
plant   346 SIFLRRDAALKPGFVVKKLRKVKPGKILKYQKVMKEVRRYFDYTHLNGSVNEI----WRQVTKKI 406

  Fly   432 P 432
            |
plant   407 P 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ttvNP_001356963.1 Exostosin 102..393 CDD:335188 69/277 (25%)
Glyco_transf_64 477..737 CDD:337333
ARAD2NP_199306.1 Exostosin 66..364 CDD:281069 69/277 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D789556at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.