DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ttv and AT5G41250

DIOPT Version :9

Sequence 1:NP_001356963.1 Gene:ttv / 36614 FlyBaseID:FBgn0265974 Length:772 Species:Drosophila melanogaster
Sequence 2:NP_198941.1 Gene:AT5G41250 / 834126 AraportID:AT5G41250 Length:561 Species:Arabidopsis thaliana


Alignment Length:313 Identity:73/313 - (23%)
Similarity:113/313 - (36%) Gaps:83/313 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 FLVYIYPPEPLNSLGAAPPTSANYQKILTAIQESRYYTSDPTAACLFVL----GIDTL--DRDSL 162
            |..::|..||:           .:.::|.  ...|.|  :.|.|.||.:    |.|.|  ...::
plant   229 FATHMYSLEPI-----------LHSRVLK--HPCRVY--NETQAKLFFVPYYGGYDVLRWHYRNV 278

  Fly   163 SEDYVRNVPSRLA-RLPYW---------NNGRNHIIFNLYSGTWPDYAENSLGFDAGEAILAKAS 217
            |||    |..||. .:..|         |.|::| :|.|...|| |:..:...:  |...|....
plant   279 SED----VKDRLGIEVLKWLNSKESWRRNAGKDH-VFVLGKITW-DFRRDKDPW--GSRFLELQE 335

  Fly   218 M----GVLQLRHGF---DVSIP---LFHKQFPLRAGATGTVQSNNFPANKKYLLAFKGKRYVHGI 272
            |    .:|..|..:   |::||   .||   |.........|.......::.|::|.|       
plant   336 MQNPTKLLIERQPWQVNDIAIPHPTYFH---PRTDDDITRWQIKIMSKLRRNLVSFAG------- 390

  Fly   273 GSETRNSLFHLHNGRDMVLVTTCRHGKSWRELQ--DNRCDEDNREYDRYDYETLLQNSTFCLVPR 335
            |:...|.     |.....|:..|......|.|.  :..|.......|      |.|:|.|||.|.
plant   391 GARPDNP-----NNIRSTLIEQCISSNQCRFLNCTNESCTNPKNVLD------LFQDSEFCLQPP 444

  Fly   336 GRRLGSFRFLEALQAGCIPVLLS-------NAWVLPFESKIDWKQAAIWADER 381
            |.........::|.:|||||:.:       .||.||    .|.::.:::..|:
plant   445 GDSATRRSVFDSLISGCIPVIFTPYTAYYQYAWHLP----EDHRKYSVYISEQ 493

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ttvNP_001356963.1 Exostosin 102..393 CDD:335188 73/313 (23%)
Glyco_transf_64 477..737 CDD:337333
AT5G41250NP_198941.1 Exostosin 176..508 CDD:281069 73/313 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D789556at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.