DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ttv and AT5G25310

DIOPT Version :9

Sequence 1:NP_001356963.1 Gene:ttv / 36614 FlyBaseID:FBgn0265974 Length:772 Species:Drosophila melanogaster
Sequence 2:NP_197913.4 Gene:AT5G25310 / 832603 AraportID:AT5G25310 Length:480 Species:Arabidopsis thaliana


Alignment Length:405 Identity:93/405 - (22%)
Similarity:162/405 - (40%) Gaps:90/405 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 PSFLGAHDMQELQLLQSNQSKSLDSSKHLVT-------------RKPDCRMETCFDFTRCYDRFL 105
            |..|...::.| |.|...::..|::|.::.|             |.|.....:..:..:   ||.
plant    92 PEKLNRRNLVE-QGLAKARASILEASSNVNTTLFKSDLPNSEIYRNPSALYRSYLEMEK---RFK 152

  Fly   106 VYIYP--PEPLNSLGAAPPTSANYQKILTAIQESR--YYTSDPTAACLFVL-------------- 152
            ||:|.  ..||...|......|...:.:|.:::.|  :.|.||..|.::.|              
plant   153 VYVYEEGEPPLVHDGPCKSVYAVEGRFITEMEKRRTKFRTYDPNQAYVYFLPFSVTWLVRYLYEG 217

  Fly   153 GIDTLDRDSLSEDYVRNVPSRLARLPYWN--NGRNHIIFNLYS-GTWPDYAENSLGFDAGEAILA 214
            ..|.....:...||:|.|.:   ..|:||  ||.:|.:...:. |.....|...| |:....::.
plant   218 NSDAKPLKTFVSDYIRLVST---NHPFWNRTNGADHFMLTCHDWGPLTSQANRDL-FNTSIRVMC 278

  Fly   215 KASMGVLQLRHGF----DVSIP---LFHKQFPLRAGATGTVQSNNFPANKKYLLAFKGKRYVHGI 272
            .|:..     .||    ||::|   |:..:...:...:.|:.::..|    ||..|.|.  ||| 
plant   279 NANSS-----EGFNPTKDVTLPEIKLYGGEVDHKLRLSKTLSASPRP----YLGFFAGG--VHG- 331

  Fly   273 GSETRNSLFHLHNGRDMVLVTTCRHGKSWRELQDNRCDEDNREYD----RYDYETLLQNSTFCLV 333
                        ..|.::|       |.|::.     |.|...|:    ..:|...:::|.||..
plant   332 ------------PVRPILL-------KHWKQR-----DLDMPVYEYLPKHLNYYDFMRSSKFCFC 372

  Fly   334 PRGRRLGSFRFLEALQAGCIPVLLSNAWVLPFESKIDWKQAAIWADERLLLQVPDIVRSIPAERI 398
            |.|..:.|.|.:||:.:.||||:||..:||||...:.|:..::..|...:.::.:|:.||..|:.
plant   373 PSGYEVASPRVIEAIYSECIPVILSVNFVLPFTDVLRWETFSVLVDVSEIPRLKEILMSISNEKY 437

  Fly   399 FALRQQTQVLWERYF 413
            ..|:...:.: .|:|
plant   438 EWLKSNLRYV-RRHF 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ttvNP_001356963.1 Exostosin 102..393 CDD:335188 77/322 (24%)
Glyco_transf_64 477..737 CDD:337333
AT5G25310NP_197913.4 Exostosin 147..432 CDD:281069 77/327 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3137
eggNOG 1 0.900 - - E1_KOG1021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 44 1.000 Inparanoid score I2684
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D789556at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X187
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.870

Return to query results.
Submit another query.